Conserved Protein Domain Family
Bac_DnaA_C

?
pfam08299: Bac_DnaA_C 
Click on image for an interactive view with Cn3D
Bacterial dnaA protein helix-turn-helix
Statistics
?
PSSM-Id: 311966
View PSSM: pfam08299
Aligned: 725 rows
Threshold Bit Score: 32.367
Threshold Setting Gi: 0
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2Z4S_A         345 DELIEIVAKVTGVPREEILSNSRNVKALTARRIGMYVAKNYLKSSLRTIAEKF-NRSHPVVVDSVKKV 411
gi 123726235   431 DDIQRIVCEHLGISQEKMRSKTRKRDVTRARQIAMYFTKKHTQHSLKDIGLHFgGRDHSTVIHANNav 498
311_pfamImport   2 EVIQEQVVAHYTISLDALKGKSRKKELVMARQTAMHLIKKYTTHSLKTIGAYFgGRDHTTVIHAVE-- 67
173_pfamImport   2 DKIIDVVTSHFNIKVADIKGKTRLREVVLPRQIAMFLTKEYTELSLKAIGYHFgGRDHSTVIHAIQTI 69
284_pfamImport   2 DTIIEAITEHYKVRTADLKGKSRLREIVLPRQVAMYLTKELTNLSLKSIGYHFgGRDHSTVIHAIQT- 68
239_pfamImport   2 DTIQEIVSDYYDVSIADLKGKSRKKELVYPRQVAMYFAKELTDLSLKSIGYHFgGRDHSTVIHAIQTI 69
100_pfamImport   2 DSVQEAVASFFNVTIADLKAKSRKRELVHPRQIAMYLAKEKTDLSLKSIGYHFgGRDHSTVIHAVQT- 68
291_pfamImport   2 DAIEEIVAAFFQVTLEQLKGKTRKKEIAIARQFAMYLTKEYTDLPLKAIGWHFgKRDHSTVIHACK-- 67
269_pfamImport   2 ETIVEYTAKVFNLSSDHLRAKTRKKDVVRARQVAMYLAKQMTNHSLITIGLHFgGRDHSTVIHGINT- 68
63_pfamImport    2 PYIQEVVCEYFGIEREQLLSKTRKREIALPRQLAMYFAKEFTNATFTKIGEEMgGKDHSTVMYACDT- 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap