Conserved Protein Domain Family
HCV_NS5a_1a

?
pfam08300: HCV_NS5a_1a 
Hepatitis C virus non-structural 5a zinc finger domain
The molecular function of the non-structural 5a protein is uncertain. The NS5a protein is phosphorylated when expressed in mammalian cells. It is thought to interact with the ds RNA dependent (interferon inducible) kinase PKR. This domain corresponds to the N-terminal zinc binding domain.
Statistics
?
PSSM-Id: 311967
View PSSM: pfam08300
Aligned: 2 rows
Threshold Bit Score: 145.596
Threshold Setting Gi: 130461
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 130461 2006 IPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTT 2067
gi 130461 2006 IPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTT 2067
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap