4AEZ,3ESL


Conserved Protein Domain Family
Mad3_BUB1_I

?
pfam08311: Mad3_BUB1_I 
Click on image for an interactive view with Cn3D
Mad3/BUB1 homology region 1
Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of the binding of BUB1 and MAD3 to CDC20p.
Statistics
?
PSSM-Id: 311972
View PSSM: pfam08311
Aligned: 164 rows
Threshold Bit Score: 89.4606
Threshold Setting Gi: 74956291
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4AEZ_F          53 KERMGHERKIETSeslD--DPLQVWIDYIKWTLDNFPQgeTK-TSGLVTLLERCTREFVRNPLYKDDVRYLRIWMQYVNY 129
gi 193620275    61 KEKEKYDHAIRTY---EgdDPLAPHFEYIKWLEQIYLK--HGpESNLWPLIEETVQKFKNDEKYKQDPRFITILINFIEN 135
gi 242008295    49 RQRNEYEIRLRNS---CseDPLSDWCSYIYWIEQSFPK--QGrEGKLHVVLQKCLNKFKDNEQYMNDIRFVRLCIKYADL 123
gi 568249035    39 ADKHAWEEAIRRY---VgnDPLDLWFNYVNWYEQNR-S--YDrVNNLRPILEKCLAQYQETESYKQDIRLVKLWMKFIDM 112
gi 170056434    21 sdKRAWDEAIRAY---QgpDPLDIWFNFICWLEQHKML---DkEGGFRKILEQCLSNFENYENYKQDVRMVKLWMKFIDM 94
gi 321463581    42 EQRKAMELDIMAY---DgsDPLELWSRYIQWVEENYPQ--GGkESDLQMVLEQCLEKLRDSPQYQSDPRLLEIYLRYLDL 116
gi 1036907339   32 KDKQAWEHAISLY---QgpDPLDHWYNYICWYE-NLAH--SDpELKFRETLERCLTEYEHSEYYRQDARMVRLWLKYIAM 105
gi 118784980    20 ADKQAWEDAIRGY---NgtDPLDLWFNYITWYEQNR-S--FDrLNNLRSIVEKCLLLYQDAEGYKQDTRMVKIWMKYIDM 93
gi 749797991    44 QEKQMYEDAIKHye---geDPLESWYEYILWVEQSYPK--NGhESHIGRLLQQCLTLFEKEVKYHQDRRYIRLWINYISM 118
gi 645011755    44 QERQMYEDTIKNyv---gdDPLENWYDYISWVEQSYPK--SGhESPLARLLQQCLTNFEKETKYHQDQRFIRLWINYISM 118
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*..
4AEZ_F         130 IDEPVELFSFLAHHHIGQESSIFYEEYANYFESRGLFQKADEVYQKG 176
gi 193620275   136 QSNAIELYQTVYNQGIGTMCALFYRAWAELLDRYNDFKRVDQIFLLG 182
gi 242008295   124 EDNTVELLSQIHRHGIGVSCAELYIAWAEKYAVDNCFKKANAVYERG 170
gi 568249035   113 QAEPPSWYQMLYNKKIGTQCASFYISWAHYCNVAKAYKQADSIYNLG 159
gi 170056434    95 QANPLNLYQFLYKKNVGTQCACFYIGWAHYYDAANAFKQAESIFNLG 141
gi 321463581   117 TENNAEWYNQLYGAGYFHKLASFYIHWAETLEACSNFKEGTRIYMLG 163
gi 1036907339  106 QTDPLHFYQVLFQRGSGRQVAAFYIGWASYYESREQFKDAEAVFNLA 152
gi 118784980    94 QQSPASYYQMMYKKNIGTQCASFYIGWAE-----RDYKQAVSIFNLG 135
gi 749797991   119 QKNPLELYHLLHNNGIGTTVADMYRAWAFELEQIEDYKRADEVYLMG 165
gi 645011755   119 QKNPLELYQLLYNNGIGTMVADLYRAWAFELEQVEDFKRADEVYMIG 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap