Conserved Protein Domain Family
cwf21

?
pfam08312: cwf21 
cwf21 domain
The cwf21 family is involved in mRNA splicing. It has been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe. The function of the cwf21 domain is to bind directly to the spliceosomal protein Prp8. Mutations in the cwf21 domain prevent Prp8 from binding. The structure of this domain has recently been solved which shows this domain to be composed of two alpha helices.
Statistics
?
PSSM-Id: 311973
View PSSM: pfam08312
Aligned: 171 rows
Threshold Bit Score: 28.5397
Threshold Setting Gi: 768739871
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....
gi 74632324     71 EHERKRKVEVACMELQDKLEEEGQkGEEEIEEEVNTLRRQLTLK 114
gi 954527124   696 lHERKRKIELKCLEMQDLMTEQNY-PEEEIQEKVDKYRALLRKK 738
gi 123413532    49 DHESRVKIETECYLLRKKLREQNI-PEDQIKTRVDKFREEQLEK 91
gi 321468954    58 DHERKRKLELKCLEFREDLEEKGI-EEEIIEAKLLEYRASLVQK 100
gi 328719919    58 DHDRKRKVELKCIELEQSLEDQGF-SQDEIIKKINNFRVTLLgk 100
gi 514686713    64 DHYRRREIELKCAELEDSMTEQGC-TEDEIEAKVDEYRAQLLEK 106
gi 802732765    58 DHQRKRQIEIKVTEFEMLMENKGF-EQEDIDKKVADYRRLLLSQ 100
gi 393907984    58 EHNRKRHIELKCADFEMLMENKGF-DEAEIQKKVNEYRKLLQSQ 100
gi 309356162    58 DHNRKRQIEVKCTEFEMLLEDKGL-DDEDIEKKVNEYRQNLLKQ 100
gi 1005970939   59 DHQRKRKIELKCVELETQMEDEGC-TQEEIDKAVARLREKLKAR 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap