Conserved Protein Domain Family
SCA7

?
pfam08313: SCA7 
SCA7, zinc-binding domain
This domain is found in the protein Sgf73/Sca7 which is a component of the multihistone acetyltransferase complexes SAGA and SILK. This domain is also found in Ataxin-7, a human protein which in its polyglutamine expanded pathological form, is responsible for the neurodegenerative disease spinocerebellar ataxia 7 (SCA7). Ataxin-7 is an integral component of the mammalian SAGA-like complexes, the TATA-binding protein-free TAF-containing complex (TFTC) and the SPT3/TAF9/GCN5 acetyltransferase complex (STAGA). This domain is a minimal domain in ataxin-7-like proteins that is required for interaction with TFTC/STAGA subunits and is conserved highly through evolution. The domain contains a conserved Cys(3)His motif that binds zinc, thus indicating this to be a new zinc-binding domain.
Statistics
?
PSSM-Id: 336994
View PSSM: pfam08313
Aligned: 42 rows
Threshold Bit Score: 74.1786
Threshold Setting Gi: 552913970
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 121788845     9 PEPKPKTSKLNGPVDVEKQCGVILP-NGQSCARSLTCKGHSMSAKRAVPGRSMPFDMLLVPYQEKL 73
gi 242003271   253 rdkkkSERKADKIYDPDKHCGVIND-NGKPCVRSILCKVHQVALKRAVPNRTMPYDMLIKILKNQN 317
gi 667632213    33 NSDAKKTNKVKKVFSVDRYCAVPE--NGVPCKNSLTCRLHSLEQKNKVQGRVYPVEDLIRIWKREK 96
gi 556963745   272 nGHKSYKKISRKECDLKRHCGVVNPdTKTACTRLLTCKIHSVHQRREVLGRPKDFDQLVSELKAAS 337
gi 1032916853  224 lpPKTHRKMARKEFDLNRQCGVINPeTKKICTRLLTCKIHSVHQRREVPGRTKDFDVLVAELKASS 289
gi 156403877   177 KSPRKVIPTREREFDADKHCGVWVAdQQKKCTRSLTCKTHALSLRRAVLGRRKPFDELLAEHKARV 242
gi 1126201254  203 fdKERKIPLKDREYDPNKHCGVWLPdMKKPCTRSLTCKTHALSLRRAVPQRRKPFDELLAEHKARA 268
gi 390349809   396 vKSDKNVPCKDRRYDPDKHCGVWSDeHKRHCTRSLTCKTHSLSLRRAVQGRRLPFNELLAEHKARS 461
gi 357631747   341 RKSSKTKANNQREYDPNKHCGVVTAeNPKPCTRSLTCKAHALSLRRTVDGRSKPFDTLLAEHRASR 406
gi 642910626   190 KKSKKSSTKALREYDPDIHCGVVDG-LKGPCTRSITCSNHKIQLRKSVPGRSKNIHVLIAEKKAAK 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap