Conserved Protein Domain Family
Plexin_cytopl

?
pfam08337: Plexin_cytopl 
Click on image for an interactive view with Cn3D
Plexin cytoplasmic RasGAP domain
This family features the C-terminal regions of various plexins. Plexins are receptors for semaphorins, and plexin signalling is important in path finding and patterning of both neurons and developing blood vessels. The cytoplasmic region, which has been called a SEX domain in some members of this family, is involved in downstream signalling pathways, by interaction with proteins such as Rac1, RhoD, Rnd1 and other plexins. This domain acts as a RasGAP domain.
Statistics
?
PSSM-Id: 311994
View PSSM: pfam08337
Aligned: 54 rows
Threshold Bit Score: 353.804
Threshold Setting Gi: 780038707
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A         47 AIPFLDYKHFASRIFF-----------PE---------------AgtltavmirdigeDSEQTTVDE-KCLAFAELIRDK 99
gi 166215089 1194 GPELINFPHFVENLLWsdnnlt----------------sapslaRtl----------pV---------TLAQFHALLSFK 1238
gi 762148464  384 GIPYHSYQSYTQYILF-----------PKeveaat----iasllEh-----------sGFSSKNAEK-AMDQFDKLMSNK 436
gi 780038707  897 GMPFVSGADYIRNMLFwglkvqpmtndPE------------------------------LPQESIKQ-AMSEFSKLLNRK 945
gi 779995622  421 GVPFVNALDYSKNMLFaglavlppttdPE------------------------------YMNSDLET-AMIMFSRQLSNP 469
gi 341888335  956 qPEIVDFSRFMENLLWaentlt-----------------vpilaRtl----------pM---------ALAQFHALLSFK 999
gi 514701107 1444 eahprpfGEYARRVYF-----------TAldthpl---pvrprfPgt----------nD---------CIEQFTFFLQQD 1490
gi 699256024 1160 riiylppwEYITQVLF-----------NQrsghpv------------------ldenamVGQGTVKQdALKSLLSVIKNK 1210
gi 260810068 1243 GIPFLDYRTYMMRVLF-----------PGqdmhp-----vlketNvr----------eS-RRVQWEQ-AMNQFSALLNNK 1294
gi 196005607 1252 GAPQHPFRVYIHKMLF-----------PNvkhgemhpvfapisvR-------------GSRKSRLED-SLSSFLDLLLRD 1306
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        100 QFLSCFVHALEEQK-NFSIKDKCTVASLLTLAL--HGDLLYLTEIMEDLLQSLMDQSSnAN--PKLLLRRTESIVEKLLT 174
gi 166215089 1239 GFIFTIVEAAESDV-SISTSEKSMLASLLISVL--LRNFSYCTEVVVDLLRAHIARSVqNKr-AELLFRNSDSVVEKMFS 1314
gi 762148464  437 YFVKSLIGTLEKQR-KITLSDKAQFAANFSVIM--MGKMRDFFEIVNCLLSTLVD-SAnKKq-HKTLFNRFESISLRLLS 511
gi 780038707  946 EFLMQYIQGLDEAK-NLKQKDRVNIASLLSTILttEGRFHYLTDVMLTLMAEKIEESD-ENr-LKQLFKSVGSILEKLIS 1022
gi 779995622  470 DFLTNFIKQLEEQR-KPKRRDRVNIASLITALLvtEGKFGYFTETLFKLLEESIEEGA-ESgrARSLFRRTETIVEKLLS 547
gi 341888335 1000 EFIFTIVDVAESRN-SISTSEKSMLASLLISVL--IRNFSYCTEIVISLLKTHIAKAVeNKr-AELLFRNSDSLVEMMIS 1075
gi 514701107 1491 DFLRAFVGVMEGEGrAFSVRDRCQVASLLMCSA--NGDEAMGTHTLSTLLDQYFTAn--SRrdPRLMLRRTESVAEKLLT 1566
gi 699256024 1211 DVLLVLVRTLEEQR-KFTVQEKGNMASLLTICL--FDDLPYYTRVMLELLTGLIQKHV-SRn-PKLLLRRSESVVEKMVS 1285
gi 260810068 1295 HFLLTFIRIMEESReSFSSRD----------------------NILKTLLLHMIEKSV-ERn-PKLMLRRTESVVDKMLT 1350
gi 196005607 1307 KFLITFIATLEKQP-DFKPKDKCNIASFLIVAL--HENMDYVTKVLMKLLIEMIRKLP-PKgqPQLFLKRNDSITEKLLS 1382
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        175 NWMSICLYGFL-RESVGQPLFLLVSALTQQISKGPVDSVTEKALYTLSEDWLLCQAQDFEPLKLKVVFAVgtgeeISESL 253
gi 166215089 1315 KWMSICLYSHL--TPQMNSYFYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRESVDTKTLKIRVIPFEk----CDESI 1388
gi 762148464  512 HWLSVSLYPYL-KEGGGSSLFMLYKSTQTVVEKRPVDEVTGEAKNTLSEDNFLREKIDCLTMKLEIDLNGn---gN--LY 585
gi 780038707 1023 NWVALCMYKHL-QKQVAYPLYVLYQAIKGQVDKGPVDAITGQAHFSLNFDYLLDEDVEFEDVTLQIVD-------KEHKV 1094
gi 779995622  548 NWISICMYQYL-KRQVAESLYLLYQSIKMQVEKGPIDITTGQSVFSLNFECLLEEEVEFNELTLSVVGRD-----RHHKY 621
gi 341888335 1076 KWWCICLYPSL--KPQMNSFYNLYKALQFQTDRGPVDAVTGDARYTINEANLLRECVETRTIIVNVIPLEn----CHDTV 1149
gi 514701107 1567 AWLTTGMHDAV-LRDAARPLYNLTQALKIYAWKGPVDAVTGAATYTLNADALLRERVEYEPLTLHVDM-------NRQVY 1638
gi 699256024 1286 HWLSINLYDECiNEQAGKPLFLLTKAVHYLVSSAPCDVIAKKAFNSLNEMTLLGTELQYETVVLHATIVEeg-gkVTTSV 1364
gi 260810068 1351 NWLSISLYPFL-KETAGQPLFMLYKAIKYQVEKGPVDAILGFARYSITEDRLLREQVDHEVLTLNVVSLPg---gPSGHL 1426
gi 196005607 1383 NWLALCLYQYS-NKRFGQPLYLLYHAIKQQISKGPVDQKTGEARYCLSEEKLLREQVDETEISVMASIG------DGQQI 1455
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        254 --EVIALTCDTIQQVKEKILQTFQRKFGFRYTQQIRDIEI-----EY-EKE-GK-FVMLQEVDDTSEIR-GH--VTMLNT 320
gi 166215089 1389 --DLEVHACDAICQVKQKVASAVYRETPYSQRPRITQFEL-----KY-KCPkRG-DVKLTDVLPIETLS-QKklPVKLFT 1458
gi 762148464  586 --TCEVLDCDTINQVKSKCLYQIYKNKPASEMPSTDEVDL-----EW-MAGkSG-RLTLSNIDQTSERG-DG--MVRRNT 653
gi 780038707 1095 leQVKVLDVDTITQAKQKILDAVYCKRQTAQQLRSNEVDL-----VL-LNGcMG-RLVLKDRDPITETR-GH--WIKANT 1164
gi 779995622  622 --YVKVLDVDCMTQVKQKILDAAYRNSHIVQQNRAHEMDL-----LWyHPGgE--ERILKDRDELNKTV-GNtkDLFINT 691
gi 341888335 1150 --RLELHSCDAIRQVKQKVAAAVYYKTPYSQRPRITQFDL-----RF-KCPrQG-EIRLVEF---RTLS-KKklPVKLLT 1216
gi 514701107 1639 --EVHVNSCDTIGQILEKL-----KLVVTTAGADVSDFDTrvlvlQR-EEG----LRVLKDIDDSSKMS-AG--WVQLNT 1703
gi 699256024 1365 --DVKVVNVDSIKQAKTKIIEAVYKDKPYSECPKPDDLDF-----ALmNSSeST-GITLSDVDGMSVVD-GK--YTKINT 1433
gi 260810068 1427 pfTVKALSCDTITQVKDKILDMAYKNIPYSTRLHADECEL-----EW-RHGrAG-QLILRDTDVTSEMN-HR--WKKLNT 1496
gi 196005607 1456 --SLKLFDCDTITQAKEKILDAIYINQPYSARPSVAEFELeav---tvRHGqPPyRLPMFDEDSSNEVYeNG--WYKLNT 1528
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        321 LKHYQVGDGACI----KVITP------------------------------------------KIhaplktqnsvkDDKN 354
gi 166215089 1459 LADYGISDGCTLemspAVYTAesyrnsladsgqssw-----------------------------------ssldrcspi 1503
gi 762148464  654 LKHYHVLDNSRM----ALLYK----------------------------------------------------------- 670
gi 780038707 1165 IKAYKVSyqqqyiyfkidsqkfn--------------------------------------------------------- 1187
gi 779995622  692 VKTYGVSDGCQV----ALIVKasmnetgtyqpvtpgvqlfqqyqe----------------hagpddvrdrdyirirtme 751
gi 341888335 1217 ISDYDVQDGSILemtpAFYALenhsqsiadsetlsc-----------------------------------tsvdinspa 1261
gi 514701107 1704 ASFYGMRDGDQL----AFVKSdtdggdarrrrnnn--------------ssssggggggggggSLfkvrtksks---rid 1762
gi 699256024 1434 LKHYNVPDNAVV----VLRPHdvenqapq---------------------------------------------dvsspl 1464
gi 260810068 1497 LEHYKVPDSCSV----ALLRKpeqqmkldrtfe-------------------nlgvnqslsssSLapl------mqGDPE 1547
gi 196005607 1529 IGHYKITDNTTL----KLHRVynrnsdtfsisttyqytrpsrnqlharynnvsnqvtlggnkeNLsqplp--------nq 1596
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        355 FSIK-Y-----------------------------------------------FHLVDp---DID-TDLs---------- 372
gi 166215089 1504 yssskY-----------------------------------------------YHLTN----PSSgTMTf---------- 1522
gi 762148464  671 -----FspdvehddeddtyvnqrspsdvditippnvqliqsvsstgslenlrqWHLVK----NIE-EEDs---------- 730
gi 780038707      --------------------------------------------------------------------------------
gi 779995622  752 sggsrI-----------------------------------------------MHLVAenqmPTE-SSTs---------- 773
gi 341888335 1262 ysfleH-----------------------------------------------YHLVK----STSgSLMc---------- 1280
gi 514701107 1763 pmaceP-----------------------------------------------WHLVK----PDT-DGTa---------- 1780
gi 699256024 1465 lpPKhM-----------------------------------------------YHLIN--------PSEeeqsngytdvq 1489
gi 260810068 1548 EGCR-Y-----------------------------------------------WHLVK----ARD-ELErsns------- 1567
gi 196005607 1597 vrEK-A-----------------------------------------------FHLMK----HSDsNTTn---------- 1614
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        373 ---------N-HPEK----KALKIKEMYLIKLLSTKVAVHSFVENLFKSIWGLp--NNKAPLAVKYFFDFLDEQAERKKI 436
gi 166215089 1523 --------kK-KSSNdsnlLPKSIPEVYLTRLLTSKGTVETYVEDFLESVLYMh--DSSYPPILKFFFDILDREASVNGV 1591
gi 762148464  731 ---------HeKPSK----LKDIGKTSHITNLMHTKLVLQDNIKEVFDSVLN----HETVPLVVHYLFGVLENLANKNSV 793
gi 780038707      --------------------------------------------------------------------------------
gi 779995622  774 -------------------LTKLDREFLAPRLLVTKKTIQTRLDEFLACVFKK---PAETPLTIKYLFDFFDKMANKYCD 831
gi 341888335 1281 --------rP-KSSTd---VPKSIPEVYLTRLLTSKGTVEAYIEDFFESVLYMh--AYKFPPILKYVFDTLDHEAEINEV 1346
gi 514701107 1781 --------aA-AAAA----ATRVPSEIFLTYLMTVKTALQPFVDDLVDAVFNI----DQPSPAVRFLFHFLDDQARKHNI 1843
gi 699256024 1490 sdagkkadeM-LDNL----MKRPFQEMFLTRMVKAKTTIQEYVDGVFNSILR----PKPISKTVRYFFQFLDREADRHKI 1560
gi 260810068 1568 -----vkrdS-RFLK----EQRAIPEIYLTRLLATKGTLQKFVDDAFSAILC----TSPVPPSIKYFFDLLDHEAKKHGI 1633
gi 196005607 1615 --------------------ERILPEAFLMCLLLTKGTLQQYTQDLFESLFTLphhSNTFPLAIKYLFDFLNSQASQMQF 1674
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8N_A        437 TDP-DVLHIWKTNSLPLRFWVNILKNPDFVFsDMEKSPHLDGCLSVIAQAFMDSFSLTDTHLDKHSPTNKLLYGKDIPQY 515
gi 166215089 1592 SE--NICQQWKANGYVLRVWANFVRNPQLVF-DVPHSISMDANLSTVAQTMMDCFSFSEPVLGAHSPSSRLLFAKDVARL 1668
gi 762148464  794 -EP-DTLLCWKSESYAMRVWATLLVRPEFLF-DIQKARHVEPCLNVIKQVFIDCFHST--KISKDSSLQKLLFAQEVPHY 868
gi 780038707      --------------------------------------------------------------------------------
gi 779995622  832 EKSeEIAEAWKSNSLPLHYWMTTLTHPSYVF-DMRQSRSADQSVSVLANMLDNACKKIRSENTQESALNRVLFYRDLPGH 910
gi 341888335 1347 ED--NISHQWKANGFVLRVWANFIKNPQLAL-DLPHSISMDANLSIIAQTMIDCFSFSEPVLSAQSPSSRLLFAKDVARL 1423
gi 514701107 1844 SDP-RTTHIWKSNAFPLRFWINLIKNPDFLL-HVQQTRTVSSGLSTVAQVIMDSCSVSDQQLGKHSPANKHLYRKEVAEY 1921
gi 699256024 1561 NDP-EVLHIWKTNSLLLRYWVNVLKNPEFVF-DLNKTDIVDSCLNVITQAFMDACTTTNRKLGHDSPSNKLLYAKDADNY 1638
gi 260810068 1634 DDP-ETLHIWKTNSVPLRFWVNVLKNPEFVF-DIFKLGIVDACLSVIAQTFIDSCSAAEHKLGKDSPSNKLLYAREIPQY 1711
gi 196005607 1675 NDP-AVVKSWKNNTLPLRYYINIIRNPQFLF-DIDKSPIVDSCLSVISQAFGDACSVSDTKVSKDSPSNRLLYAREIPRY 1752
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|....*....
4M8N_A        516 KQEVKSYYKLVKDQTSISSQELKTFLQEESKKHQNE--FNESAALRELYKYMQRYFTEI 572
gi 166215089 1669 RPLSVDLFKRVKNSPPLGMDELRTELVNMANDVSTC--KGSSLALSELLSWVRGNGIRI 1725
gi 762148464  869 QKKTEQFYKALGNKAAITDADFWSEMSRLSLLQQEHlkFSKSAALVKLYRFVNQYVEEI 927
gi 780038707      -----------------------------------------------------------
gi 779995622  911 IRTIGEYYENIKGLPPPTTEELQEDFNRITQDFSGL--FSRVATLNKLYDFTShdtgpl 967
gi 341888335 1424 RPFSADLLKRIKNFPSLSINELEIEL-----DLSTY--KGSSLALSELLSWVRGNAIRI 1475
gi 514701107 1922 KQKIANFYTAISRLPPPTDAELQASFASAQSGEQAC---DRPDAVCGLMEYALRFREQL 1977
gi 699256024 1639 KVMVKEFFINISNTPTVTQEEVTQILQKQSASYASR--FNQMVALNGIYEHLVKYREQV 1695
gi 260810068 1712 RQKVQTYYKEVQQMTAVSDQEMITLLVEETKDHTHE--FNTLAAVNELYDYAMKYQDQL 1768
gi 196005607 1753 RDKVAEFYKSIQNLPTVSEKEMMKEMKLLSETLKDD--LDKSSALLQLYDYAYSnikaf 1809
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap