Conserved Protein Domain Family
TRP_2

?
pfam08344: TRP_2 
Transient receptor ion channel II
This domain is found in the transient receptor ion channel (Trp) family of proteins. There is strong evidence that Trp proteins are structural elements of calcium-ion entry channels activated by G protein-coupled receptors. This domain does not tend to appear with the TRP domain (pfam06011) but is often found to the C-terminus of Ankyrin repeats (pfam00023).
Statistics
?
PSSM-Id: 337013
View PSSM: pfam08344
Aligned: 61 rows
Threshold Bit Score: 73.7344
Threshold Setting Gi: 641664630
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 74920716    150 CGCDECIRRSSE-DSLRHSLARVNEYRALASPSLIALSSQDPLLTAFQLSWELRNLAFAE 208
gi 1084305553  235 CSCLECETIRAE-DSLILEQQRLHTYQALSSSAYLALTTSDPVSTAFILRNELYQLASQE 293
gi 675887982   186 CDCEDCKNISER--SLIEALSRQHEYRALASSAYITVSSIDPIIHTFRLYSDLLEESELD 243
gi 541046295   219 CLCSECRRIAR---GLSKSVVTLDTYRAISSAAFLWLACSDPSLAAFRLAADLEICMQYE 275
gi 312082048   153 CSCEECSRSAHC---MTNSVILLDTYRAISSEPFLWLACTDPLLAAFNLATDLQVCEEME 209
gi 541048881   164 CICHKCKRSART---HANGVITLDTYRAISSGPFLWLACADPPLAAFKLALDLEACMQCE 220
gi 541042414   188 CYCEKCADESVR-SS--HAVVKLDTYTAISSDAFLWLACRDPLLAAFKLAADLEVCCQVD 244
gi 642921901   196 CRCMDCKAQLERdDLLHAEHLRLNLYKSVCNPAYICHSSRDPILTSFQLSTELRQCSFLV 255
gi 405968193   165 CNCQECSHKLEF-DELRLAKTRLNAYKGLASCTYISLTSEDPVLTAFDLARELRYVSTIE 223
gi 762163561   108 CNCQECSNKLVF-DQLRLAKTRLNAYRGLASSAYISLSSNDPILTAFELARELRCVAKVE 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap