Conserved Protein Domain Family
TRP_2

?
pfam08344: TRP_2 
Transient receptor ion channel II
This domain is found in the transient receptor ion channel (Trp) family of proteins. There is strong evidence that Trp proteins are structural elements of calcium-ion entry channels activated by G protein-coupled receptors. This domain does not tend to appear with the TRP domain (pfam06011) but is often found to the C-terminus of Ankyrin repeats (pfam00023).
Statistics
?
PSSM-Id: 312000
View PSSM: pfam08344
Aligned: 62 rows
Threshold Bit Score: 74.122
Threshold Setting Gi: 641664630
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 74920716   150 CGCDECIRRSSEDSLRHSLARVNEYRALASPSLIALS---SQDPLLTAFQLSWELRNLAFAE 208
gi 360045401  235 CSCLECETIRAEDSLILEQQRLHTYQALSSSAYLALT---TSDPVSTAFILRNELYQLASQE 293
gi 405955406  196 CSCTSCIEEQNRDYMVFCNRRLDTFRALASPAYISLT---DEDPVMSSFFLSKKFKQLQVME 254
gi 675887982  186 CDCEDCKNISER-SLIEALSRQHEYRALASSAYITVS---SIDPIIHTFRLYSDLLEESELD 243
gi 541046295  219 CLCSECRRIAR--GLSKSVVTLDTYRAISSAAFLWLA---CSDPSLAAFRLAADLEICMQYE 275
gi 541048881  164 CICHKCKRSART--HANGVITLDTYRAISSGPFLWLA---CADPPLAAFKLALDLEACMQCE 220
gi 675887926   46 CTCPEC-EMMEDVSLIEAKTRYTEFKCLASPPYVILS---TFDPLLYMFRLNSVLKAESKTE 103
gi 541042414  188 CYCEKCADESVRSS--HAVVKLDTYTAISSDAFLWLA---CRDPLLAAFKLAADLEVCCQVD 244
gi 156404428   97 CLCPWCQSL---GRIGTSLHRLYTYRALASPVYMSLTflsCKDPVRQAFELNKELVELADIE 155
gi 260824958  185 CPCNVCENRRKADAFRFSRWRLMMYRALASPAYISLS---SSDPIRSAFEIGGETRKLAEIE 243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap