Conserved Protein Domain Family
CTNNB1_binding

?
pfam08347: CTNNB1_binding 
N-terminal CTNNB1 binding
This region tends to appear at the N-terminus of proteins also containing DNA-binding HMG (high mobility group) boxes (pfam00505) and appears to bind the armadillo repeat of CTNNB1 (beta-catenin), forming a stable complex. Signaling by Wnt through TCF/LCF is involved in developmental patterning, induction of neural tissues, cell fate decisions and stem cell differentiation. Isoforms of HMG T-cell factors lacking the N-terminal CTNNB1-binding domain cannot fulfill their role as transcriptional activators in T-cell differentiation.
Statistics
?
PSSM-Id: 312003
View PSSM: pfam08347
Aligned: 19 rows
Threshold Bit Score: 191.067
Threshold Setting Gi: 992188579
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82175462    1 MPQLSg--gGGGGDpELCATDEMIPFKDEGdPHKEQIFAEIShseEEGDLAEIKSSLVNETEISPN----SNSH-----D 69
gi 82134789    1 MPQLG----SGGGD-DLGATDEMLAFKDEG-EQEEKIPENAF---TERDLADLKSSLVNESEGSGS----PAAA-----A 62
gi 611972952   1 MPQLGg--gGGSGD-DLGATDEMLAFKDEG-EQEEKIPQGGF---PERDLADLKSSLVNESEGAGSsgqaGSGP-----G 68
gi 45361695    1 MPQMN----SAGED-DLGASDEMISFKDEG-DQEEKIRESAF---TERDLADLKSSLVNESEVSSH----PRVPeshpeA 67
gi 551511460   1 MPQLS----SGGGD-DLGANDEMIAFKDEG-EQEEKTQENAF---TERDLADLKSSLVNESEINQS----PTSA-----A 62
gi 992188579   1 MPQLN----SGGGD-DLGANDEMISFKDEG-EQDEKIQESGF---TERDLADLKSSLVHESEIHQN----SSAA-----G 62
gi 344277300   1 MPQLSggggGGGGDpELCATDEMIPFKDEGdPQKEKIFAEIShpeEEGDLADIKSSLVNESEIIPA----SNGH-----E 71
gi 410917946   1 MPQLS----GGGGDpELCATDEMIPFKDEGdPHKEQIFAELShseEEGDLADIKSSLVNESESSPN----SNSH-----D 67
gi 260802532  26 MPQLN----GSGGD-DLGASDETISFKDEG-EQEEKSAENVS-----NDLSDIKSSLVNESESSQS----GAVP-----S 85
gi 542242370   1 MPQLS----REDGD-DLGASDELIAFKDEG-EQEEK--RNVS---AERDLDDVKSSLVNESETNSS----SDSE-----A 60
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82175462   70 Aa---RQSQITPDSYhEKHRdhp---ddGKLQD-----LYSKGh-PYPSYPGYIMMTnmn------------nePYMNNG 125
gi 82134789   63 DpeaiRRVQDPQRVYqEKLPdhmd-dagMKHQDp---gMYKGS--AYSGYPFLMLSD-----------------PYLPNG 119
gi 611972952  69 QtetlRRASNSQRLYqDKLPdal--eegLKAQDsssvgMYKES--VYSGYNLLVHYPangvsagtgagtgagagTGPGAV 144
gi 45361695   68 M----RRTQDAQLVYqDKLTdhm--edgVKHQDe---gMYKGS--GYPSYPFLMLSD-----------------PYLSNG 119
gi 551511460  63 Vr---RGHHGEQRVFqDKHRehl--dgvSKQQDg---gMYKSP--AYPGYPFLMLPD-----------------PYLPNS 115
gi 992188579  63 Vr--aRGQPDDQRVYpEKHRdqqhldevPKHQDg---gMYKA---FNSGYPFLMLPD-----------------PYLPNG 117
gi 344277300  72 Va---RQAQTSQESYhDKARehp---deGKHPDg---gLYNKGp-SYSGYSGYIMMPnmn------------ndPYMSNG 129
gi 410917946  68 g---vRQSQI-PDSYhEKHRdhq---edGKLQD-----LYCKGh-PYSGYPSYSMMSnm-------------daSYMNNG 121
gi 260802532  86 E-----GSKPPLQSYpREd---------SRRGDe---gSKAESvpVVSRGPAYLTPGgvivs-------nmgvyPH-PNG 140
gi 542242370  61 Dr--rPEPRPGVESRaRQNQvcee-alrKQQRDg---rLLQPS--PYVGYPFFMFPDlgn-----------lcsPYLANG 121
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82175462  126 SLSPpip-------------------------rtSNKVPVVQPSHAVHPLTPLITYSDEHFAPG-PHSGH--HPQ---DV 174
gi 82134789  120 SMSPl-----------------------------SNKVPVVQPSHGVHPLTPLIPYSNDHFSHG-SHSPH--LPA---DI 164
gi 611972952 145 SGAGq-----------------------------PLHTKPGQPSHGVPQLTPLY----EHFSSH---PTH--VSA---DI 183
gi 45361695  120 SVSAl-----------------------------SSKVPVVQPSHGVHPL---IPYNNESFSHG-SHSTH--LPA---DL 161
gi 551511460 116 SVSPs-----------------------------SNKVSVVQQSHGMHPLTSLLPYSNDHFSPS---PPH--LPT---DM 158
gi 992188579 118 PVSPsr-------------------------------------------------------------------------- 123
gi 344277300 130 SLSPpip-------------------------rtSNKVPVVQPSHAVHPLTPLITYSDEHFSPG-SHPSH--IPS---DV 178
gi 410917946 122 SLSPpmp-------------------------rtSNKVPVVQPSHAVHPLTPLITYSDEHFAPG-SHSGH--HPH---DG 170
gi 260802532 141 SLAAsa---------------------------tSNKVSVVHGPPHPGPLTQLMMYSNEHFAPGt--PPHigVPPnsiEV 191
gi 542242370 122 ALTAgartylpfqwplldvpgrasvrdtatpshlSSSVPMVQHPHVSH-LHPLLSYSPEAFSPPrASPGF---------- 190
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 82175462  175 NPKQaGMPRHHPGPDIPNFYPLSPGGVGQMTPPLGW 210
gi 82134789  165 SQKQ-AVHRPSQTSDIPGFYPLPPAGVGQITPSMGW 199
gi 611972952 184 NQKQ-GVHRPLQTTDLSSFYSLSPGGVGQISHTMGW 218
gi 45361695  162 NQKQ-GVHRPAQTADIPTFYPLPSGGVGQISPSVGW 196
gi 551511460 159 SQKT-GVHR-HQSQDLSGYYSLPPGGVGQITPSMSW 192
gi 992188579     ------------------------------------
gi 344277300 179 NSKQ-GMPRHPPAPDIPTFYPLSPGGVGQITPPLGW 213
gi 410917946 171 SNKQ-GMPRQHPGPDMANFYSLSPGGVGQITPPLGW 205
gi 260802532 192 DPKT-GIPRPRHPADLPPMYAIPPNQLPQLGPSYPk 226
gi 542242370 191 SPEAaGVSRSPHAS----CYPVSPGAMPQIPHPLGW 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap