Conserved Protein Domain Family
DUF1729

?
pfam08354: DUF1729 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1729)
This domain of unknown function is found in fatty acid synthase beta subunits together with the MaoC-like domain (pfam01575) and the Acyltransferase domain (pfam00698). The domain has been identified in fungi and bacteria.
Statistics
?
PSSM-Id: 312010
View PSSM: pfam08354
Aligned: 71 rows
Threshold Bit Score: 77.2257
Threshold Setting Gi: 736642451
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
2UVA_G       1013 VPALDENFEYWFKKDSLWQSEDIEAvyGQDVGRTCILQGPVAAKYSKVIDEPIKDIL 1069
gi 81761226   785 VPAIDADLARWWGLDTLWQSQNERY----GANSVRVIPGPVSVAGIDRVDEPVAELL 837
gi 736642451  775 VPIIDGDLKRWLGLDSLWQAQDASY----PASAVRIIPGPISVGGITEIDEPVASIL 827
gi 927266309  791 VPIIDGALLRSWGTDGLWQSHDPRY----RADQVRIIPGPVSVAGITSVNEPIADIL 843
gi 914385713  839 VPAIDNDLLRWWGQDQLWQSEDPRY----SADSVRIIPGPISVAGITTVDEPVADIL 891
gi 610391989  833 VPAIDEDLLAWWGKDCLWQAQDDRY----SADQVRIIPGPVSVSGITTVNEPVADLL 885
gi 644982367  826 VPVIDDDLLRWWGQDSLWQAQDDRY----PADAVRVIPGPVAVAGIKTKNEPIATIL 878
gi 753884660  806 VPVIDAEVRRWFRADTFWQAHDERY--GANADAVCIIPGPEAVEGIERANEPIAELM 860
gi 502126577  771 VPVIDTDVRRRWRRDTLWQAHDEHY----EADEVCIIPGTAAVAGIEQANEPVAQIL 823
gi 966754958  849 VPVIDKDVRRWWRSDSLWQAHDARY----DADQVCIIPGPAAVAGITRMDEPVGELL 901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap