2FGE


Conserved Protein Domain Family
M16C_assoc

?
pfam08367: M16C_assoc 
Click on image for an interactive view with Cn3D
Peptidase M16C associated
This domain appears in eukaryotes as well as bacteria and tends to be found near the C-terminus of the metalloprotease M16C (pfam05193).
Statistics
?
PSSM-Id: 337025
View PSSM: pfam08367
Aligned: 183 rows
Threshold Bit Score: 185.741
Threshold Setting Gi: 123426231
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FGE_A         483 PDPEKATQEEVEEKNILEKVKAAXTEEDLAELARATEELKLKQETPdppEALRCVPSLNLG-DIPKEPtyvptevgding 561
gi 432911929   502 PDHDYTEKQATAEDQKLQQKVQALTDKDREKIYQKGLELLAAQSQt---QDASCLPALKVS-DIQPTTpptavqlssaag 577
gi 573893220   503 PDELYFEKQAKAEEEKLQQKVERLSESDKKDIYEKGLQLLSLQSTs---QDASCLPSLKVS-DIQPTIpvtpvemgsage 578
gi 780080722   474 PQEDYVEQQEREEKEKLDGLVARLTETDKMDIYERGLELAEEQKRE---EDMTCLPSLKVS-DIDAKAkrtavenrhigg 549
gi 1005962800  482 ASEDYLTEYTAKENALLSEKTDKLTPEEKEKIYQQGIELMDYVDd---nMDASCLPCLDVNgDISRKMittnlnhsqias 558
gi 291001025   511 PDPKYFENQEKNENERIEKISNSLTESEKIKLIEQYKEMEKAKESQe--kNVELLPTVTIS-DLSRQImdpqnvqslpgs 587
gi 524150781   460 PSKELGKIRREKEEKTLTNVLNSMTDVQKQQLQIEQKQLDAFQQAPdtlENLNTLPKLNLE-DIEAKVqkipsklmdleg 538
gi 524497699   458 PSYTAGEERRNREKDRILRITSGWDDRTREEYIAMQQELEKWQSSTdtkEALESLPSLAIE-DIDDKPedfaceyerykg 536
gi 123426231   483 PVKNFIEDRNKKVQNELNDLQNTLSDEEKLKIVETAKKLKKHVEEPk---pLHLLPSVKPK-DIERSLipltm----ske 554
gi 47087301    501 PDERFLEKQAEAEEQKLQQKIQILSSEDRKDIYEKGLQLLAVQSTT---QDASCLPALKVS-DIEPIIpytpvqpgaagg 576
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FGE_A         562 vkVLRHDL-FTNDIIYTEVVFDIG--S--LKHELlPLVPLFCQSLLEXGTKDLTFVQLNQLIGRKTGGISVYPLTSSVRG 636
gi 432911929   578 vpVQLCEQ-PTNGLVYFRAMCSLN--T--LPEDLrLYVPLFCSVLTKMGCGALDYRQQAQQMELRTGGMSASAQVVPDSA 652
gi 573893220   579 vpVQYCAQ-PTNGMVYFRAMCSLN--T--LPEDLkIYVPLFCNVITKMGCGALDYRQQAQQIELKTGGMSVTPQVIPDCT 653
gi 780080722   550 vhTQFCEQ-PTNGITYFRALFTPD--N--IPDDLqIYLPLFCNVITKMGAGELDFIEFAQKEELKTGGISTSRHIAQYHS 624
gi 1005962800  559 ipVQISPQ-PTNTVVYFRSLIHLP--EseLPIDLkPYWPIFCELITELGAGSRDHKQMDQEIKMRTGGLEARSHLCESID 635
gi 291001025   588 peFHLNVVkGTNGIVQVTSIVPISlaE--IPDHLqKFVPIFGNLLVRVGTSQMDYLQLAHQIELHTGGIDASPLIIPSLE 665
gi 524150781   539 ckVLKHPT-ETNGIYYYALYFNID--H--LDLNQiSTLSFICSLLGNISTIKHSAKDLSTKIRLLCGTMNYSINTYEKTN 613
gi 524497699   537 cdVLLHPI-NTDGILYVTLYFDID--G--ISADNiKILSLMNEIIGNSRTLKHDGSKIQALLRMYCGSLDSGIVSYAGNE 611
gi 123426231   555 ngIWVFEV-PTNGIVYGRIRCEVN-----LNDLLiRDTRIFANCFAAIGCGDLDDEQFSIQEDLYTGGLVPSVVVDTDTT 628
gi 47087301    577 vpVQYCEQ-PTNGMVYFRAMSNIN--S--LPEDLkIYVPLFCSVITKMGSGMLDYRQQAQRIELKTGGLSVSPQIIPDTE 651
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FGE_A         637 K-D-Epc-sKIIVRGKSXAGRADDLFNLXNCLLQEVQ-FTDQQRFKQFVSQSRARXENRLRGSGHGIAAARXDAXLNIAG 712
gi 432911929   653 H-I-DtfeqGILLSSSCLERNLPHMFHLWSDIFNSPH-FENEERLRVLVTMSAQELANGISYSGHMYAMTRAGRHLTPAG 729
gi 573893220   654 D-L-DmyeqGILLTSLCLERNLPDMLNLWGDIFNSAH-FDNEEHLRVLVMMAAQELSNGVSYSGHLYAMIRAGRTLTSAG 730
gi 780080722   625 D-V-MqyeqGIGLSSFCLDRNLPDMFDLLLRVFTSPR-LNDMERLATLVRMEAAELANSIVYMGHAFAMKRAGSSLSPSG 701
gi 1005962800  636 N-L-DeyqtGILLYSHCLERNLEAMLHLWSDILNHLR-YDEDEHLTQIIKRMASERSEKLSQSGHTFVMVRAASTLKGSG 712
gi 291001025   666 K-L-NdfsfALKFSSYCLERNVEKMIELMREIYTNTNfFGNLNYLQSCIDQSASDAASGILQSGHHYAKLHASSSLSFYD 743
gi 524150781   614 K-E-Nq--vYFKASFSTLEQNEKEALQLLVEIIQESV-FDQEKMIHDILKQRIISLKQAITMSGHSLSMKRVLAMVSSSG 688
gi 524497699   612 N-VsDsvkyYIAFS--ALEEKIQPAMELIAEFINDCC-FDDLKDIKDIVHQYIVDFRDGVTSSGIGAAMSRVASSWSLSG 687
gi 123426231   629 SkE-DnpklYVILSFSCLERNIEKTLSLLRSVLFEPY-LENKEQIIALTNMLASEYTDDIMDSGSTFASICSQSKLRRSS 706
gi 47087301    652 D-L-DlyeqGIILSSSCLERNLPDMFQLWSDLFNSPR-FDDEERLRVLVMMSAQELSNGISYSGHMYAMTRAARSLTPTA 728
                          250
                   ....*....|....*
2FGE_A         713 WXSEQXGGLSYLEFL 727
gi 432911929   730 DLQETFAGMEQVKFV 744
gi 573893220   731 ELQETFDGMHQVKFM 745
gi 780080722   702 RLHEIAGGMTQVSFL 716
gi 1005962800  713 AFNEICSGLSHIVFL 727
gi 291001025   744 YLVNSTSGIGAMKFI 758
gi 524150781   689 VIDEYSSGIAYYKWL 703
gi 524497699   688 VVGEYSGGITYYNWL 702
gi 123426231   707 AIEEIIEGVTFLKRI 721
gi 47087301    729 DLQESFSGMDQVKFM 743
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap