Conserved Protein Domain Family
Bact_transglu_N

?
pfam08379: Bact_transglu_N 
Bacterial transglutaminase-like N-terminal region
This region is found towards the N-terminus of various archaeal and bacterial hypothetical proteins. Some of these are annotated as being transglutaminase-like proteins, and in fact contain a transglutaminase-like superfamily domain (pfam01841).
Statistics
?
PSSM-Id: 337031
View PSSM: pfam08379
Aligned: 476 rows
Threshold Bit Score: 44.4389
Threshold Setting Gi: 505428938
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123534670   2 LRVKHETVYRYPGPASLAYNAAWLEPLSGDGQMRIEHRLKVDPKPQFQNLRTDAFGNQMHYFEV-HKPHSALKVVSEAIV 80
gi 81742749    3 YRICHQTTYTYSAPVALAPHDLRLIPRSDGHQRLRSLSLEILPTPQGHSSVLDVYGNHIQRYWWlPQPTTSLMIQVTSEV 82
gi 75343162    3 YQITHSTLYTYGHPVELGSHCVKLCPRTDGQQRLRQFHLEVDPLPRQHTRLLDPDGNVADRFWFdPKPVQSLKFVTTAEV 82
gi 504978018   3 YRITHTTTYKYSQPVELSSHIVRLRPRCDVAQKLLSFDVEITPTPVGAYKSVEIDGNANYKYQF-EGKTELLRFQVTSGV 81
gi 497240052   3 YQINHTTEYSYEQPVALQPHIIRLRPRSDNTQILQSFQLSITPTPIQKSQSVDLDGNAIAKVWFdKEPTQSLVIHAKSLV 82
gi 504974994   4 YQIEHVINYAYDRPVTFAPHQLRLYPRSNIHQSVLSCELSLSPTPQKLVATVDLDGNNALVAWFdDNPATHLQIRAHSTV 83
gi 504936624   3 YFIQHQTTYNYAQAIELLPHTIRLRPRVSGSQLLHQFSCQVLPLPQNQTLVLDAEGNSVIHLWWgRQPTQQLQVQITAEV 82
gi 501733254   3 YYIHHSTTYTYSQGVILQPHLVRLRPRCNGDQSLLKFDLTIDPQPQGQTQILDPEGNAILRLRWaETPVTQLTLQVESEV 82
gi 493669164   3 YKIVHTTIYTYTKYVELTPHIVRLRPRSDAFQTLQNFAIDVVPEPKGISAIVDLNGNDVLKLWF-DEPTKELKIKVSSQV 81
gi 505005078   3 YQISHQTTYTYSQTVSLNPHFVRLCPRCDHWQKLHNFSLLISPQPQGISELIDLDGNNVSKVWF-NTPTNQLNLQILAQV 81

                 .
gi 123534670  81 E 81
gi 81742749   83 E 83
gi 75343162   83 E 83
gi 504978018  82 E 82
gi 497240052  83 E 83
gi 504974994  84 a 84
gi 504936624  83 E 83
gi 501733254  83 E 83
gi 493669164  82 E 82
gi 505005078  82 E 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap