Conserved Protein Domain Family
Bact_transglu_N

?
pfam08379: Bact_transglu_N 
Bacterial transglutaminase-like N-terminal region
This region is found towards the N-terminus of various archaeal and bacterial hypothetical proteins. Some of these are annotated as being transglutaminase-like proteins, and in fact contain a transglutaminase-like superfamily domain (pfam01841).
Statistics
?
PSSM-Id: 312027
View PSSM: pfam08379
Aligned: 484 rows
Threshold Bit Score: 44.4439
Threshold Setting Gi: 505428938
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123090145   3 YRIRHITEYKYAARVSSCYNLAQMVPRSTLRQTCERNFISVSPHPAFT-GKRTDYFGNTSYHFELQRAHKT-LIITSESE 80
gi 506412108   3 YLLRHVTAYTYRNAVTHARCTLRLTPRDGEGQRVLSHRLRIHPAPQDR-ETIRDFFGNAATTLTVETPHRA-FRIEAVSR 80
gi 506303805   3 YSLRHLTTYRYARAVRFARCNLRLRPRDGEGQRVLESALHVTPTPTSR-LARRDFFGLDTLTLTLDEPHRE-FTVEAVSR 80
gi 501588348   3 YDIHHVTTYEYGTPVRYAHCSLRLSPIDLPGQKVLSNRLTIDPTPSQM-IERLCFFGNRVSSMTISTEHSE-LVVEVDTS 80
gi 557037337   3 YRIQRDERVDFSAPVREHHFECRIAPWDDASQSLTSLQIDLE--PIAEwASHRDCFGNQVHRAALLRAH-DlCQVHLVAE 79
gi 504590587   3 YHIEQACRIRFASAAREHHVQIRLAPWDDESQSLIRIMLAVE--PEVLaVAGYDGFGNLAHHFAVLGAH-ReLSFAMVAE 79
gi 501445278   3 YLIEHETILDYPTPVREHHLELRLTPRQDAGQRLISHRIELEPA-AER-HSYQDYFGNGVDYFCVTAPHTC-LITRLTAE 79
gi 501243651   3 YQVRHLTTYLYEKPVTFARCALRLTPWRGADQAVLDSHLTITPHPTRL-DEHVGQFGEQVVTATLETPHRS-LKILARSH 80
gi 501275588   3 YTLRHRTAYRYGRPVHFARCTLRLKPQDCEGQSVLASAVTIDPSPARA-VMRRDYLGIDAVAITLETPHTA-FSVEALST 80
gi 501293113   3 YLLRHVTSYAYRDAVTHARCVLRLTPATGEGQRVLSHQITIQPHSHRR-ATGADFFGNATTTLTVETPHRA-FRIEALSR 80

                 ..
gi 123090145  81 VE 82
gi 506412108  81 IE 82
gi 506303805  81 Va 82
gi 501588348  81 VD 82
gi 557037337  80 VE 81
gi 504590587  80 VE 81
gi 501445278  80 VE 81
gi 501243651  81 VA 82
gi 501275588  81 VR 82
gi 501293113  81 ID 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap