Conserved Protein Domain Family
Reoviridae_Vp9

?
pfam08978: Reoviridae_Vp9 
Click on image for an interactive view with Cn3D
Reoviridae VP9
This domain is found in various VP9 viral outer-coat proteins. It has no known function.
Statistics
?
PSSM-Id: 117544
View PSSM: pfam08978
Aligned: 2 rows
Threshold Bit Score: 474.533
Threshold Setting Gi: 66360328
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W9Z_A        1 MLSETELRALKKLSTTTSRVVGDSTLALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAW 80
gi 81982661   1 MISDAVVRGFKRLALETERTAGEQTKELGSKVKLSKGEVEYLAVTKDELLEGLRQCNLKKVEQLNLDATFNGNLARAGAY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W9Z_A       81 LFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVlANPYSNKGSGLFITYEHNLISNQIETG 160
gi 81982661  81 KFIKHSMLIFMTRPIAVSNNEKYSTDVAGIPRSTTNVMVGERMIMKTVPRGT-GSPWSGQCASLIITNGISLHDSVVIPG 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W9Z_A      161 KVCVLFITSLsTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTT 240
gi 81982661 160 SIYVLFQTSL-TTYNKSNSYAYSYCVIPHSKWDPKKIKLTSETSCPSLNSMQSLANSILEGDRAPVTGLYVDIEGVTVST 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
1W9Z_A      241 SASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALS 280
gi 81982661 239 SNSLSTLPITNVANNYPICFEACVRYVEQVSEINLLYTLA 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap