Conserved Protein Domain Family
Endotoxin_mid

?
pfam09131: Endotoxin_mid 
Click on image for an interactive view with Cn3D
Bacillus thuringiensis delta-Endotoxin, middle domain
Members of this family adopt a structure consisting of three four-stranded beta-sheets, each with a Greek key fold, with internal pseudo threefold symmetry. Thus they act as a receptor binding beta-prism, binding to insect-specific receptors of gut epithelial cells.
Statistics
?
PSSM-Id: 117687
View PSSM: pfam09131
Aligned: 4 rows
Threshold Bit Score: 368.6
Threshold Setting Gi: 123291938
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I5P_A       267 LMVSSGANLYASGSGPqqTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGV 346
gi 123407195 267 LLVSSGANLYASGSGPqqTQLFTSQDWPFLYSLFQVNSNYVLSGFSGASLFTTFPNIGGLPGSTTTQALLAARVNYSGGI 346
gi 5834516   267 LMVSSGANLYASGGGPqqTQSFTAQNWPFLYSLFQVNSNYILSGISGTRLSITFPNIGGLPGSTTTHSLNSARVNYSGGV 346
gi 123291938 267 LLVSSGANLYASGSGP--TQSFTAQNWPFLYSLFQVNSNYVLNGLSGARTTITFPNIGGLPGSTTTQTLHFARINYRGGV 344
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I5P_A       347 SSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLsLRCGAFSARGNSNYFPDYFIRNI 426
gi 123407195 347 TSGSIGGPNFNQNFNCNTISPPLSTSFVRSWLDSGSDRQGVNTVTNWQTESFETTSgLRCGAFTPRGNSNYYPGYFIRNI 426
gi 5834516   347 SSGLIGATNLNHNFNCSTVLPPLSTPFVRSWLDSGTDREGVATSTNWQTESFQTTLsLRCGAFSARGNSNYFPDYFIRNI 426
gi 123291938 345 SSSRIGQANLNQNFNISTLFNPLQTPFIRSWLDSGTDREGVATSTNWQSGAFETTL-LRFSIFSARGNSNFFPDYFIRNI 423
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
1I5P_A       427 SGVPLVIRNEDLTRPLHYNQIRNIespsGTpgGARAYLVSVHNRKN 472
gi 123407195 427 SGVSLVLRNEDLKRPLYYNEKRNIespsGTpgGARAYMVSVHNKKN 472
gi 5834516   427 SGVPLVIRNEDLTRPLHYNQIRNIespsGTpgGARAYLVSVHNRKN 472
gi 123291938 424 SGVVGTISNADLARPLYFNEIRDI----GT--TAVASLVTVHNRKN 463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap