Conserved Protein Domain Family
YpM

?
pfam09144: YpM 
Click on image for an interactive view with Cn3D
Yersinia pseudo-tuberculosis mitogen
Members of this family of Yersinia pseudo-tuberculosis mitogens adopt a sandwich structure consisting of nine strands in two beta sheets, in a jelly-roll topology. As with other super-antigens, they are able to excessively activate T cells by binding to the T cell receptor.
Statistics
?
PSSM-Id: 72561
View PSSM: pfam09144
Aligned: 3 rows
Threshold Bit Score: 224.588
Threshold Setting Gi: 42543297
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PM4_A         3 IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGL 82
gi 501053525  35 IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGL 114
gi 75406979   35 IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLYSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGL 114
                         90       100       110
                 ....*....|....*....|....*....|....*..
1PM4_A        83 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 119
gi 501053525 115 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 151
gi 75406979  115 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap