Conserved Protein Domain Family
CBM27

?
pfam09212: CBM27 
Carbohydrate binding module 27
Members of this family are carbohydrate binding modules that bind to beta-1, 4-manno-oligosaccharides, carob galactomannan, and konjac glucomannan, but not to cellulose (insoluble and soluble) or soluble birchwood xylan. They adopt a beta sandwich structure comprising 13 beta strands with a single, small alpha-helix and a single metal atom.
Statistics
?
PSSM-Id: 117765
View PSSM: pfam09212
Aligned: 2 rows
Threshold Bit Score: 316.151
Threshold Setting Gi: 75424822
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75424822  525 IQNASAYEIikQFSFDSDMNNVYADGTWQANFGIPAIS---TPKTRCLRVNVDLPGNADWEEVKVkISPISELSETSRIS 601
gi 506400096 495 AQYVLAEEV--DFSRPEEVKNWWNSGTWQAEFKTPDIEwngEVGNGALQMNVVLPGKGDWEEVRV-VRKFDQLPVCEILE 571
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75424822  602 FDLLLPRVD-VNGALRPYIALNPGWIKIGVDQYHVNVNDLTTVTIHNQQYKLLHVNVEFNAMPNVNELFLNIVGNKLAYK 680
gi 506400096 572 YDIYIPDVEgLTGRLRPYAVLNPGWVKIGLDMNNTSIDSGELVSFDGKKYRKFHVRIEFDKTPGVNELHIGVVGDHLEYD 651
                        170
                 ....*....|...
gi 75424822  681 GPIYIDNVTLFKK 693
gi 506400096 652 GPIFIDNVRLYKK 664
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap