Conserved Protein Domain Family
M3

?
Click on image for an interactive view with Cn3D
M3
Members of this family of viral chemokine binding proteins adopt a structure consisting of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds. They bind with the CC-chemokine MCP-1, acting as cytokine decoy receptors.
Statistics
?
PSSM-Id: 117766
View PSSM: pfam09213
Aligned: 3 rows
Threshold Bit Score: 640.536
Threshold Setting Gi: 81925316
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MKF_A        14 SGVSTQSVDLSQIKRGDEIQAH------CLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWvSVEELGQEII 87
gi 123829766  38 SGVSTQSVDLSQIKRGDEIQAH------CLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWvSVEELGQEII 111
gi 81925316   22 SVVNIETYPFPEDDTKEDMRDYlflvqnCLLQDNFNATYCSDSFEKLDKRSHFTLPDTCNVKTTFLVNY-NRHKYGIFKF 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MKF_A        88 TGRLPFPSVGGTPVNDLVRVLVVAESNtpeeTPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGM 167
gi 123829766 112 TGRLPFPSVGGTPVNDLVRVLVVAESNtpeeTPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGM 191
gi 81925316  101 ESRLPLPTMASATSGRVIKVLVLAEAG----RPWKRHWANLAMVTYSNVVRLTDFNAKFRTRFSRIWSVTLDRHEVDLDL 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MKF_A       168 LTRATFLEQWPGAKVTVMIPYSSTFTWCGELgAISEESAPQPSLSARSPV---CKNSARYSTSK-FCEVDGCTAETGMEK 243
gi 123829766 192 LTRATFLEQWPGAKVTVMIPYSSTFTWCGELgAISEESAPQPSLSARSPV---CKNSARYSTSK-FCEVDGCTAETGMEK 267
gi 81925316  177 TFAGFLFAAPESVQLTLLMDYVPTFTWCGQI-SLNDPDLPVPSFQAIRTLpvmCFPMWRYLNGQdFHHQDGCHQESKWWN 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MKF_A       244 MSLLTPF---GGPPQQAKMNTCPCYYKYS-VSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCA 319
gi 123829766 268 MSLLTPF---GGPPQQAKMNTCPCYYKYS-VSPLPAMDHLILAGLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCA 343
gi 81925316  256 PTHIIPRlnpGTESHNITLNTCVCHVKYNdLQELDTAHRIKILTISNFFGFYKPLYVLVTYFGSSDVNVEGQAPPLQYCV 335
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
1MKF_A       320 LQMTSHD-GVWTS--TSSEQCPIRLVEGQSQNVLQVRVAptSMPNLVGVSLMLEGQQYRLEYFG 380
gi 123829766 344 LQMTSHD-GVWTS--TSSEQCPIRLVEGQSQNVLQVRVAptSMPNLVGVSLMLEGQQYRLEYFG 404
gi 81925316  336 VFIHRGNyGFFRTrqRGDPDCPCHFSLGRDEIVLVGHYV--DVKRIVGITIFFDGQEHRISYLG 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap