Conserved Protein Domain Family
Fve

?
pfam09259: Fve 
Click on image for an interactive view with Cn3D
Fungal immunomodulatory protein Fve
Fve is a major fruiting body protein from Flammulina velutipes, a mushroom possessing immunomodulatory activity. It stimulates lymphocyte mitogenesis, suppresses systemic anaphylaxis reactions and oedema, enhances transcription of IL-2, IFN-gamma and TNF-alpha, and haemagglutinates red blood cells. It appears to be a lectin with specificity for complex cell-surface carbohydrates. Fve adopts a tertiary structure consisting of an immunoglobulin-like beta-sandwich, with seven strands arranged in two beta sheets, in a Greek-key topology. It forms a non-covalently linked homodimer containing no Cys, His or Met residues; dimerisation occurs by 3-D domain swapping of the N-terminal helices and is stabilized predominantly by hydrophobic interactions.
Statistics
?
PSSM-Id: 117805
View PSSM: pfam09259
Aligned: 2 rows
Threshold Bit Score: 209.124
Threshold Setting Gi: 258588263
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                   10        20        30        40        50        60        70        80
           ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OSY_B   2 SATSLTFQLAYLVKKIDFDYTPNWGRGTPSSYIDNLTFPKVLTDKKYSYRVVVNGSDLGVESNFAVTPSGGQTINFLQYN 81
3F3H_B   2 SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYN 81
                   90       100       110
           ....*....|....*....|....*....|.
1OSY_B  82 KGYGVADTKTIQVFVVIPDTGNseEYIIAEW 112
3F3H_B  82 SGYGIADTNTIQVFVVDPDTNN--DFIIAQW 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap