Conserved Protein Domain Family
ParG

?
pfam09274: ParG 
Click on image for an interactive view with Cn3D
ParG
Members of this family of plasmid partition proteins adopt a ribbon-helix-helix fold, with a core of four alpha-helices. They are an essential component of the DNA partition complex of the multidrug resistance plasmid TP228.
Statistics
?
PSSM-Id: 117819
View PSSM: pfam09274
Aligned: 3 rows
Threshold Bit Score: 135.579
Threshold Setting Gi: 496091430
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
1P94_A        1 MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE 76
gi 75465973   1 MALEKNHTSSKKMTFGEHRDLDKVVDSPLPSGKSKRVNVNFNEEKHTRFKAACVKNGTSITDVINQLVDNWLTEHE 76
gi 496091430  1 MALTKQHTS-KTMSFGEHRDLEKVVNS-TPTGKQKRVNVNFDEEIHIRFKAACAKQGTSITDVIKDLVDNWLKEND 74
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap