Conserved Protein Domain Family
UBA_3

?
pfam09288: UBA_3 
Click on image for an interactive view with Cn3D
Fungal ubiquitin-associated domain
Members of this family of ubiquitin binding domains adopt a structure consisting of a three alpha-helix bundle. They are predominantly found in fungal ubiquitin-protein ligases.
Statistics
?
PSSM-Id: 117832
View PSSM: pfam09288
Aligned: 6 rows
Threshold Bit Score: 85.6165
Threshold Setting Gi: 74659734
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
1TTE_A       161 EESDLYGIDHDLIDEFESQGFEKDKIVEVLRRLGVKSLDPNDNNTANRIIEELLK 215
gi 74694199  157 EEAQLYGIDKGLVDTLVAQGFEREKVVQALRRLGIKTMDKGDNEKANIILEELLK 211
gi 74661423  159 DEAQLYGIDPEIVKEFESQGFEKNKIVEALRRLGVKSLDPNDNATVNKIIEELLK 213
gi 74660535  173 DEADLYGIDQDLVTQFVNQGFDRQNVIEVLKRLNIKSMSMEDNETANKILEELLK 227
gi 74659734  158 DEIARLGLDRDAVEGFASMGFGKDKIIAVFKKLQIKK--PQSQEDEQRVVEELLN 210
gi 758972610 174 DPILLAGLKREHVDQFVNMGFETNKVIEALKKLNYRGAN-VRNITDDTVLNELLK 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap