Conserved Protein Domain Family
Luciferase_3H

?
pfam10284: Luciferase_3H 
Click on image for an interactive view with Cn3D
Luciferase helical bundle domain
This domain is found associated with the the catalytic domain of dinoflagellate luciferase. Luciferase is involved in catalyzing the light emitting reaction in bioluminescence. The structure of this domain has been solved. This domain has a three helix bundle structure that holds four important histidines that are thought to play a role in the pH regulation of the enzyme.
Statistics
?
PSSM-Id: 118808
View PSSM: pfam10284
Aligned: 8 rows
Threshold Bit Score: 124.94
Threshold Setting Gi: 75099644
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
1VPR_A         2 CEK-GFEAGDNKLGGALNAKHVEKYG-DNFKNGXHKPEFHEDGLHKPXEVGGKKFESGFHYLLECHE 66
gi 75109040  868 CEK-GFEVGDNVKGGALNSKQLEKFG-DNFKDGLHQPTFHEEGLHKPVEAGGRVYETGFHYLLECHE 932
gi 75162018  108 CEKtGLELSGTAKGGALSAAHVEHLDsEAFREGLHQPKFHTDGLHMPHTSGEKTYETGFHYLLEVHD 174
gi 75099644  490 CDQ-GFEAHDNPKGGALTAAHVESLGkENFKNGLHAPNFHDDGLHKPMEAGGKVYSTGFHYLLEAHD 555
gi 75162018  486 CDN-GFEVHDNLKGGPVSAAHVEALGkEHFEDGLHKPKFHDDGLHKPMEAGGKVYETGFHYLLEAHE 551
gi 75099644  867 CEK-GFEAGDNKLGGALNAKHVEKYG-DNFKNGMHKPEFHEDGLHKPMEVGGKKFESGFHYLLECHE 931
gi 75109041  859 CEK-GFEVSGDAKGGPVNGKQIEKYG-DNFKNGLHQPTFHPEGPHKEMEVNGKKYDSAFHYLLECHE 923
gi 75099644  112 CEKtGLESGGVAHGGALNAAQVAHLDeDAFKGGLHRPKFDSEGLHKPHTSGGKTYETGFHYLLEAHE 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap