Conserved Protein Domain Family
Luciferase_cat

?
pfam10285: Luciferase_cat 
Luciferase catalytic domain
This domain is the catalytic domain of dinoflagellate luciferase. Luciferase is involved in catalyzing the light emitting reaction in bioluminescence. The structure of this domain has been solved. The core part of the domain is a 10 stranded beta barrel that is structurally similar to lipocalins and FABP.
Statistics
?
PSSM-Id: 118809
View PSSM: pfam10285
Aligned: 3 rows
Threshold Bit Score: 661.284
Threshold Setting Gi: 75099644
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75099644  191 PLCADPFSPEIEQLCQALVREAQDDKTLCFENFTKPCPQLTKKQVELCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKT 270
gi 75099644  568 PLCKDPYGKEVQSMVENLLVQANVDTTNAFDNFKQPCPQLTKEQVAMCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKT 647
gi 75109041  936 PLCKDPYGPEVSALVEKLLKEAEDDRTLCYNNFQDPCPELPKEQVAKCKGFDYGDKTLKLPCGPLPWPAGCPEPGYVPKT 1015
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75099644  271 NPLHGRWITVSGGQAAFIKEAIKAGMLGAAESHKIMADTDHHQTGGMYLRINQNGDVCTVDASVAKFARAKRTWKSGHYF 350
gi 75099644  648 NPLHGRWITVSGGQVAFIKEAIKSGMLGAAEAKKIIADTDHHQTGGMYLRINQYGEVCTVDASVAKFARAKRTWKSGHYF 727
gi 75109041 1016 NPLHGRWITVSGGQAAFIKEAIKSGMLGQAEAHKIMADTDHQKTGGMYLRINQFGDQCTVDASVAKYARAKRTWRSGHYF 1095
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75099644  351 YEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGRCFRIERRAFERNGLMIMRQATEVAGKISFVFYVKVSNDPESKPIPLQ 430
gi 75099644  728 YEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGHCFRIERRAFPCGPYMFLRQATEVGGKISYVFYVKVSNDPGSKPIPLQ 807
gi 75109041 1096 YEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGKCFRIERRAFQAGPYTFLRQSTEVAGKISFVLYVKVSNDPGSEPIPVQ 1175
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 75099644  431 SRDYTALAGLDNVPDSLGNPYTCEAKDLDYPIKRDTWLDKNQEEMLKQRSIVGTAF 486
gi 75099644  808 SRDYTALAGQDNAPDNLGKPYKCTARDLDAPTKRDGWLDTNKGAMLDQREKVSKAF 863
gi 75109041 1176 SRDYTALAGCDNVCTNLGKPYPSTAKDLDYPKKRDAWLDQNKRQMLYQRDVVASTF 1231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap