Conserved Protein Domain Family
ICAP-1_inte_bdg

?
pfam10480: ICAP-1_inte_bdg 
Beta-1 integrin binding protein
ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin. The cytoplasmic domains of integrins are essential for cell adhesion, and the fact that phosphorylation of ICAP-1 by interaction with the cell-matrix implies an important role of ICAP-1 during integrin-dependent cell adhesion. Overexpression of ICAP-1 strongly reduces the integrin-mediated cell spreading on extracellular matrix and inhibits both Cdc42 and Rac1. In addition, ICAP-1 induces release of Cdc42 from cellular membranes and prevents the dissociation of GDP from this GTPase. An additional function of ICAP-1 is to promote differentiation of osteoprogenitors by supporting their condensation through modulating the integrin high affinity state,
Statistics
?
PSSM-Id: 119000
View PSSM: pfam10480
Aligned: 2 rows
Threshold Bit Score: 373.256
Threshold Setting Gi: 82077465
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82077465   1 MFRKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSG--NAVSDASAEFRVKYVGAIEKLQFDMSK 78
gi 4758578    1 MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGqsNNNSDTCAEFRIKYVGAIEKLKLSEGK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82077465  79 TLQEPLDLINYIDAAQQDGKLPFVPGDEEMILGVSKYGVKVASLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTT 158
gi 4758578   81 GLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTT 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 82077465 159 DTKQQECSIWVYQCSSAEHAQAICKVLSSSFDCALASEKP 198
gi 4758578  161 DASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap