Conserved Protein Domain Family
Plasmid_stab_B

?
pfam10784: Plasmid_stab_B 
Click on image for an interactive view with Cn3D
Plasmid stability protein
This family is conserved in the Enterobacteriales. It is a putative plasmid stability protein in that it is expressed from the operon involved in stability, but its actual function has not yet been characterized.
Statistics
?
PSSM-Id: 119304
View PSSM: pfam10784
Aligned: 12 rows
Threshold Bit Score: 78.9234
Threshold Setting Gi: 363642981
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
2JD3_A         8 KKYTLYLHPEK-AADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL 78
gi 983412612   5 RKCSFYIYPERnAADRVADGFLEKLPQKERGRAMRAMMLCGAALMKQDERLPFLIAEFLTESTSMQDIQRII 76
gi 208645      6 RTIAFKLNPDVnQTDKIVCDTLDSIPQGERSRLNRAALTAGLALYRQDPRTPFLLCELLTKETTFSDIVNIL 77
gi 647216482   8 RRCSFELFPDErTGDKIADELIANEKLKERGRFMRAMLVTGAAFAAIDKRLPLLISELLTENTTLDDINKVI 79
gi 378021802   8 KKFTLYLHPEK-AADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL 78
gi 499198302  10 RKFTSYLQLDC-EADRRALDVVESISQRVRGDFLRNAIITTAALHQLDPRLPVLLATLYNGQLTSEQLVNLV 80
gi 938841319   4 GQYSFYLHSDD-RTDIAAMATISTISQPLRGEFIRTAATAGAVVYQVDARLPALIPVFFAGQLSAVRLCAVM 74
gi 920479127   8 KKLSLYLHPED-SADCLALAEIETVPRKKRGELYRQALITGLIMHQLDERIPAVLTALFTRELNADEVISQI 78
gi 545230869   6 RRISFYLKPAAvKNEGKACAWLDSLTPEARKSGQRVAFLAGLALMKINPAEAYRLAAWADDEALSLTQTRTE 77
gi 446133425   6 RRISFYLKPAAvKSEQEACNYLDSLPASERSRAQRAAFLAGLALIKRNPAFAYWMAEWPEDNLPFNTVSIKE 77
gi 363642981   1 RRYTLTLQNG--RSGERVESVLTEASSRLRGDLLRNLIITGLALHTTAPELPRLLASMPVPPTSVSELQALV 70
gi 446368074  10 KKVVAYLHPALyPQDNLTQQTIDSLPVQMRGDFYRQSLICGAALYSVAPRLLTLISVFFSEKITAENLVKLI 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap