Conserved Protein Domain Family
TMEM61

?
pfam15105: TMEM61 
TMEM61 protein family
The function of this family of transmembrane proteins has not, as yet, been determined. Members of this family remain uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 150 and 211 amino acids in length.
Statistics
?
PSSM-Id: 317517
View PSSM: pfam15105
Aligned: 8 rows
Threshold Bit Score: 270.174
Threshold Setting Gi: 558175682
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74750872   13 ASTLRYCMTVSGTVVLVAGTLCFAWWSEGDATAQPGQLAPPTEYPVPEGPSPLLRSVSFVCCGAGGLLLLIGLLWSVKAS 92
gi 641738589  13 ASTLRYCMMVSGTVVLVAGTLCFAWWSEGDAGPPPGQSAPPTGCPEPGAPGALLRSVSFFCCGAGGLLLLFGLLWSVKAS 92
gi 564305792  13 ASTVHYCMTVGGTVVLVVGTLCFAWWSEGNTAVQPGSLAPTMEQPLPETPLTWLKSFSFLCCSMGGVLLFFGLLWSIQES 92
gi 752435754  13 APVLRYCMTVSGTVLLVAGTLCFAWWSEGDAGAQPGQPAPPTGRPVPEAPSPLLRSVSFFCCGAGGLLLLFGLLWSIKAS 92
gi 545498699   8 ASTLRYCMTVSGTVLLVAGTLCFAWWSEGDAGTQPGQPAAPTGHPMPEAPNPLLRSVSFFCCGAGGLLLLLGLLWSIKVS 87
gi 914908742  31 ASTLRYCMTIGGMVFLVAGTLCFAWWSEGDAGAQPDQRVPPAEHAVSQAPRPLLRSVSFFCCGAGGLLLLCGLLWSFKAS 110
gi 558175682  13 ASTLRYCVSVSGTVFLIAGTLCFAWWSEGDKGVQPSQPAPPAGYPAPEAPGSLLRSISFICFGAGGLLLLLGLLWSIKAS 92
gi 343403837  13 ASTLRYCMTVSGTVVLVAGTLCFAWWSEGDAAAQPSQPVPPARRPVPEAPGPLLRSVSFFCCGAGGLLLLFGLLWSIKAH 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74750872   93 IPGPPRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAW 172
gi 641738589  93 TQKLPRWDPYHLSRDLYYLTVESSEKQSCRTPKVITVPTYEEAVCCPLAGGPLILPASPVEEDLERSASGDALPGAQPPL 172
gi 564305792  93 TKKSSQGDLYRFSRDLYHLAVESPEKEGYRPPKETAIPTYEETMYCPLAEGPLQCPVQ-AEEDLQCHAPEDARLGSTSFS 171
gi 752435754  93 TRGPPRWDPYRLSRDLYYQTVESSEKESYRLPELAAIPTYEEAMCCSLAEGPPTPAADPVEGGLKDSASGDALLGTQDPL 172
gi 545498699  88 TRGPPRRDPYHLSRDLYYLTVEPSEKESYRVPKVAAVPTYEEAVCCPLAAGPPTPPAQPVEEGLEDRASGDALLGAQCP- 166
gi 914908742 111 RRGPPRWDPYRFSRDLYYLTVETSEEENCRTPKVVAIPTYEEATHCPLAEGPPAPTVCPKEEGQKCDDAGDALLGTPPPL 190
gi 558175682  93 AWGSPRSDPYHLSRDLYYLTVEPSEKESCRTPELVAIPTYEEAVHCPLVEGPLAPPAYPTEEDLPCSASGAALLGGQPPS 172
gi 343403837  93 TRGPPRWDPYHLSRDLYYLTVEPSEKESSRTVS-AAIPTYEEAMRCPLVEGPLTSPAHTLEEDLELSASGDALLRAQSAL 171
                        170       180       190
                 ....*....|....*....|....*....|.
gi 74750872  173 PPPSYESISLALDAVSAETT--PSATRSCSG 201
gi 641738589 173 PPPSYESLIFAAGGISGETA--RGAACSLTG 201
gi 564305792 172 PPPSYESIILAHGAVSG-----SSAASSSPG 197
gi 752435754 173 PPPSYESVIGATHGVSGETA--PGTAGSCPG 201
gi 545498699 167 PPPSYESIVGAGQGICGQTV--PGPGCSCPG 195
gi 914908742 191 APPSYESVFLALDACSGDTTpaPGAACSFPG 221
gi 558175682 173 PPPSYESVIPAAAVIPGETI--PAGSDHSer 201
gi 343403837 172 PPPSYESLILAADSTSGETT--PGAASSCPS 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap