Conserved Protein Domain Family
TMEM117

?
pfam15113: TMEM117 
TMEM117 protein family
The function of this family of transmembrane proteins has not, as yet, been determined. Members of this family are as yet uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 181 and 504 amino acids in length.
Statistics
?
PSSM-Id: 317523
View PSSM: pfam15113
Aligned: 8 rows
Threshold Bit Score: 665.264
Threshold Setting Gi: 156356968
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 155372185   4 DFRYYFQHPWSRMIVAYLVIFFNFLIFAEDPVSHSQTEANVIVVGNCFSFVTNKYPrGVGWRLLKVLLWLLAILIGLIAG 83
gi 241998830 202 DFRYFLQHPYARLFVSYFVIFCNFLVFAEDPISHSRTESEIPVFGNVFSFMCTKYPpEWGWRCLKVLLWLVALFWGLVCG 281
gi 260827226   4 DFRYYFQHPYARLFVAYLVVFCNFLMFAEDPVSHGITPANVIVVGNIYSFIVDKYP-GGAWNVFKVFMWLLAIVVGMILG 82
gi 156364430   2 NSRYYFQHPYLRLFICYFIIFCNFLIYAEDPVAHSLSQCTIPVIGNVFAFVVNNYP-PNGWAALKFFMWFFGMITGMLIG 80
gi 156356970   1 -WRYYFRHPWSRIITSYLVVFLNFFIFAEDPVSHSYEECTIDYIGDVYTFLFIRWP-SGSFVLVKLGTWLFAISLGLLIG 78
gi 156356968   2 GFKYWLRHPYLRLMTSYLVVFCNFLIFAEDPVSHSYTDCVIDIIGNIYAFILARYPpHGGYVALKIFMFVLAFITGMVIG 81
gi 47224398    6 RFRYYFQHPWSRLIVAYLVTFFNFLIFAEDPVSHSQTEARMIVVGNCFSFLFNKYP-GLGWNVLKVVCWILAMITGLLAG 84
gi 148232818   4 DFRYYFQHPWSRIIIAYLVTFLNFLMFAEDPISHSQTEANVIVVGNCFSFMITKYP-GVGWGVLKVILWLLAIVTGLFAG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 155372185  84 KFLFHRRLFGQLLRLKMFRED-HGSWMTMFFSTILFLFIFSHIYNTILLMDG-TMGAYIITDYMGIRNESFMKLAAVGTW 161
gi 241998830 282 KYIIHHFLLRNLCRLKMFREE-QGTWMIMLLTMVIFVYMFSLVYNFFLMSAYpEPELFRINALMGITNANFMKFAACGTW 360
gi 260827226  83 KFLVHKLFFGRLLRLKMFHRD-GGSWFIMFLTTLMSLFIFSNIYNGIILAAG-LNYDLQISDVMGLRNSSFMKAAALGTW 160
gi 156364430  81 KFFVHKLLLRKWMKLSMFQED-KGSWMVMFLTTIVLLFVFSLIFNGLVSLGG-SIAAYKVTSFLGFTNKTFMKAAAMGTW 158
gi 156356970  79 KFLLHKWLFCQKLKLKIFTEDgQGSWMVMFLSCFFFLFVFSYAYNGFLMLEGkYMDTLHASSRMGMQNQTFMKFAAMGTW 158
gi 156356968  82 KYFVHKFLLCRVFRLKMFSEEgQGSWMIMFLMVLVFTFVWSFCFNEFLLLGRpDYLRYKVSSNMGIENQTFMKFAAIGTW 161
gi 47224398   85 KFIFHRQLFGRYLRLKMFRED-HGSWMTMFFSTILFLFIFSHIYNLFLLMAG-NMKPHMVTDYMGIRNESFMKIAAVGTW 162
gi 148232818  83 KFLFHQRLFGHVLRLKMFRED-HGSWMTMFFSTILFLFFFSHIYNLFLLMAG-GMSIYIINEYMDIRNESFMKVAAVGTW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 155372185 162 MGDFVTAWMVTDMMLQDKPYPDWGKSARAFWKK-GNVRIILFWTVLFTLTSVVVLVITTDWISWDKLNRGFLPSDEVSRA 240
gi 241998830 361 LGDFLTAWMVTDMMLQDQLYPSWARSLRAFWQShGRTRIIVFWSGTVILSTVVISLIVSDYISWDYLNREFVATTELSRA 440
gi 260827226 161 MGDFVTAWMVTDMMLQDTLYETWARPVRHWWRQ-GWHRIILFWAVLLSLTGVVVMVITTDYIDWDYLNRGFLPTNELSRA 239
gi 156364430 159 MGDFVTAWMVTDMMLQDKLYPHWNKRLRKWWQA-GWNRIVMFWIVLIVATVIVATAITTDYLDWDRYNRWIVSSNELSRA 237
gi 156356970 159 LGDFFTAWMVTDMMLQGLKYDNWAKGVRVFWNK-GLNRVYVFWFVALAMTIVVSTAISTDYLDWDRISRNFMPTNELSRA 237
gi 156356968 162 FGDFITAWMVTDMMLQEDQYEWWSRGLRRWWRR-GLNRVYAFWGVAFTMTVIVCTAITTDYLDWDRISDDFMPTNELSRA 240
gi 47224398  163 MGDFVTAWMVTDMMLQDQNYPDWAGAARRFWKR-GNNRIVLFWTVLISLTSVVVLVISTDWISWDNLNRGFLPSDEVSRA 241
gi 148232818 161 MGDFVTAWMVTDMMLQDNQYPEWGKPARCFWRR-GNTRIILFWTVLFSLTSVVVLVITTDWISWDKLNWGFLPSDEVSRA 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 155372185 241 FLASFILVFDLLIVMQDWEFPHFMGDVDVNLPGLHTPHMQFKI-PffQKIFKEEYHIHITGKWFNYGIIFLVLILDLNMW 319
gi 241998830 441 FLASFILVMDLLIVMQDWDFPHFVCDLDIKLPGMHAASFKYRMfQ--KYVHLPEIVFHITGKWFNYGIIIIVMLLDLNMW 518
gi 260827226 240 FLASFILVMDLLIVMQDWDFPHFMGSLDIKLPGINTTHIRLHI-P--KCLRKDEWTIHVTGKWFNYGIIMLVIILDLNMW 316
gi 156364430 238 FLAAIILVFDLCIVMQDWDFPMFRGNMDIKLPGVDTASVRIRL-P--RCLRKEKWYIHITGKWFNYGIIMLVIILDLNMW 314
gi 156356970 238 FLASFILVMDLTIVMQDWEFPHFAGALDIKLPGANTDSIDFSL-P--GCFGGERLDVYITGKWFNYGIIFIVMILDLNMW 314
gi 156356968 241 FLASFILVMDLMIVMQDWEFPLFAGGMDIKLPGINTGDINFKM-P--G------GDVHITGKWFNYGIIFIVMILDLNMW 311
gi 47224398  242 FLASFILVFDLLIVMQDWEFPHFMGDLDLNLPGMSTTHVKVKL-PvcKSIFKEEYHIHITGKWFNYGIIFLVLILDLNMW 320
gi 148232818 240 FLASFILVFDLLIVMQDWEFPHFMGDVDVNLPGLSTAHLQFRV-PylHRIFKEEYHIRITGKWFNYGIIFLVLILDLNMW 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 155372185 320 KNQIFYKPHEYGQYIGPGQKIYTVKDSESLKD--LNRTKLSWEWRSNHTNPRTNKTYVEGDMFLHSRFIGASLDVKCLAF 397
gi 241998830 519 KNQIFYYPPDYGQYTGTDNKVRTVASYAVLAT--GNRTLWTLENRQNVLNPRTNESLMEDDILMNSRYLGYPLSVKGLAF 596
gi 260827226 317 KNQIFYKPFDYGQYVGPDDSIHFVRDIDTLQGdlFNRTTLTYDWRANHTDPATNLTYLERDLHMHSKYIGFTLGVKGIAF 396
gi 156364430 315 KNQIFYNPYEFGQYTLPSHHICYIEDRAFLAT--ANETMVSYDWRATHINPATNLSYASADRKMNAKYFGYSLGVKSTAF 392
gi 156356970 315 KNQIFYEPLTYGQYTDPLGYIYTIADKQYLRW--ANDSMKTYEWRWNHVNPKTNRTYGSDDHKMNTRYHGYTLGLKSMAF 392
gi 156356968 312 KNQIFYEPFIYGQYTDPDGYIYTVMDRAWLRN--ATRETLSYAWRWNHTNPLTNVTYGLADHRMNSRYHGYPLSVKGIAF 389
gi 47224398  321 KNQIFYRPYEYGQYVGPGDKIYTVEEPETLVN--FNRSTLTYDWRSTNIDPETNRSYVERDMFLHSRYTGASLDVKCLAF 398
gi 148232818 319 KNQIFYQPSAYGQYIGPGQKIYTVEDAESLQN--LNKTTLTYEWRSNNTDPYTNRSYVEGDMFLRSRFIGSSLNVKCLAF 396
                        410
                 ....*....|....*....
gi 155372185 398 VPSLIAFVWFGFFIWFFGR 416
gi 241998830 597 LPSLLGFSMFGVLTYLYGR 615
gi 260827226 397 VPGLMAFVTFGVLIWWYGR 415
gi 156364430 393 IPSIAVFILFGLLIWFYGR 411
gi 156356970 393 VPSLLAFCLFGYLVWLFGR 411
gi 156356968 390 GPSIAAFVAFGYLAKRFSK 408
gi 47224398  399 IPSLAAFVLFGFFIWLFGR 417
gi 148232818 397 IPSLMAFVLFGFFISFFGR 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap