Conserved Protein Domain Family
APOC4

?
pfam15119: APOC4 
Apolipoprotein C4
Statistics
?
PSSM-Id: 317528
View PSSM: pfam15119
Aligned: 13 rows
Threshold Bit Score: 164.209
Threshold Setting Gi: 947205078
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2492914    28 MSTESLSPTPGPESSR-WSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLL 106
gi 1703334    28 EPEGTPTPLPAPEESR-WSLVPSSVKELVGPLLTRTRERWQWFWGPGALQGFVQTYYDDHLRDLGPRAQAWLTSSRDRLL 106
gi 694016544  31 MPPGTQSPPPEPKSH--WSQVQSKVKELVEPLVTKTRERWQWLWGPGPFQGFLQTYYHDHLKDLGPRTKAWLRSSKDGLL 108
gi 82592622   31 EPEGTLSPQPAPARSS-WSLVPGKVKEWVEPLVNRTREKWKWFWGPTAFRGFMETYYDDHLKDLGSRARAWLRSSKDNLL 109
gi 947205078  31 VAAGTPSPSLELEKSR-WSLVPSRVRELVEPLVTKTRERWKWVWGPDS---FMATYYEDHLKDLGPRTQAWLQSSKASLL 106
gi 332257022  31 AQEGTPSPPPKLKMSR-WSLVRGRIKELLEPVVNRTRDGWQWFWSPSTFRGFVQTYYDDHLRDLGPRTKAWLLESKDSLL 109
gi 664771710  49 EPTGSPSPPPAWGSSP-WGLVQSKVKELMEPLVTKVRERWQWLWGPSLFQGFMQTYYDDHLKDLGPRAKAWLHSSKDSLL 127
gi 587013739  65 VPAATPSMPPEPVDSP-WSLMKDKVKT----LVTRTREKWQWFWGPEAFQGFVQAYYEDHLKDLRLRTQAWLRSSRDSLL 139
gi 584078956  34 gtpsPPTPPPGLASSS-WNLVREKVKGLVGPLVTKTRDTWQWFQVPPAVQGFVQTYYEDHLKDLGPRAQAWLRSSKDNLL 112
gi 351716016  28 TSAEDPSPRTGPEQSS-WGL--SRLRGLVEPMVTKTRERWQWFWGPEAFQGFMQTYYDDHLKDLGPRTQAWLISSKDRFL 104
gi 884882757  99 ASVEDLSPETDPEASS-WGL--SRLRGLVELMVIRTRERWQWFWSPGVFQDFMQTYYEDHLKDLGPRTQAWLTQSKDSLL 175
gi 291622244  31 VLEESPTPSPEPKASHaWSLVPGKMKEWVQPLVTRTRERWEWFWGPGAFQGFVQTYYDDHLRDLGSRTKAWIHSSKDSLL 110
gi 532105343  28 VPTGTPRLEPGPEKSR-WSLVPGRLKELVEPLVTRTRERWQWFWRPGALQGFMQTYYDDHLKDLGPRTQAWLLSSKDSLL 106
                         90
                 ....*....|....*
gi 2492914   107 NKTHSLCPRLLCKDR 121
gi 1703334   107 NTAQGLCPRLLCGDK 121
gi 694016544 109 NKAQSLCPRLLCGDK 123
gi 82592622  110 NKAHSLCPQLLCRPS 124
gi 947205078 107 NKARSLCPKFFCSDK 121
gi 332257022 110 NKTHSLCPRLVCGDK 124
gi 664771710 128 NKTYSLCPQLLCGDE 142
gi 587013739 140 NKAHSLCPQLLCRDg 154
gi 584078956 113 NKAHNLCPQLLCGER 127
gi 351716016 105 NKTLSLCPRVLCRDp 119
gi 884882757 176 NKTLSLCPRLLCRGR 190
gi 291622244 111 NKAHSLCPQLFCGSR 125
gi 532105343 107 NKAQSLCPQLLCRDR 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap