Conserved Protein Domain Family
TMEM206

?
pfam15122: TMEM206 
TMEM206 protein family
The function of this family of transmembrane proteins, TMEM206, has not, as yet, been determined. Members of this family are remain uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are approximately 350 amino acids in length.
Statistics
?
PSSM-Id: 317531
View PSSM: pfam15122
Aligned: 9 rows
Threshold Bit Score: 567.114
Threshold Setting Gi: 81905531
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123885948  56 VRFSRTCLKNFFSVLLILVYLLLMGVAVFLVYQTITDFRDKLKHPVMSVSYKEVNMYDAPGIALYPGKARLLSCEHHWyD 135
gi 81905531   55 IRFSKACLKNVFSVLLILIYLLLMAVAVFLVYQTITDFREKLKHPVMSVSYKEVDRYDAPGIAFYPGQAQLLSCKHHY-E 133
gi 573875293  50 MGFSRTCLKNVFSVILILIYLLLMAVAVFLAYQTITDFQDKLKHPVMSVTYKEVDSFEAPGIALYPGKAQLLSCKHYFhD 129
gi 619534140  56 IGFNKACLKNVFTVILVLIYLALTAVAVFLAYQTISDFMDKLNHPVMSVSYKEVEEFAAPGIVLFPGKAHLLSCMHHYhD 135
gi 557026461  61 VRFSKTCLKNFLSGILILIYLLLAAVAGFLAYQTITDFRRKLNHPVMSVSYKEVLKYDAPGIALYPGKAQLLSCKHHYhD 140
gi 432941237  63 rRISKTCVKNVLTVVLIFIYLLLTAVAIFLAYQTISDFLEKLSQPVMSVTYKEVDSFSPPGVALFPGNAQLLSCKHHYhD 142
gi 348510737  68 MRFSKTCLKNFFTVVLIFIYLLLTAVAAFLAYQTISDFLEKLNNPVMSVIYKEVDSFSPPGIALYPGKAQLLSCKHHYhD 147
gi 82187715    3 IGFNKACLKNVFTVILVLIYLALTAVAVFLAYQTISDFMDKLNHPVMSVSYKEVEEFAAPGIVLFPGKAHLLSCMHHYhD 82
gi 327262495  43 TRFSKSCLKNVFSVILLFIYLLLMAVAIFLVYQTIADFREKLKHPVMSVSYKEVPTYDAPGIALFPGKAELLTCKHHFyD 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123885948 136 HIPPLKDPGQPGENTCVTQDISYIDPYTNKTMKHALIVQGPRDVRRRELVFLQFHLNETKQDFSAIDYLLFSSYEAFLKS 215
gi 81905531  134 VIPPLASPGQPGDRNCTTQRINYTHPFFNHTMQSALIVQGPQEVKKRELVFLQFRLNQSNEDFSAIDYLLFSSFREFMQS 213
gi 573875293 130 HMPPLVKPGQPGEVDCVKDHINYTDPFTNNTMKHALVVQGPTDVRKKELIFLQFSQNETEQDFSAISYLLFYSFKEFKGS 209
gi 619534140 136 NIPPLVALENLAKRECMKEEVIYHGPYSNQTEKRALVFRGPTDVRNRELIFLQLSRNETEEDFSAISYMIFAKFSDMLES 215
gi 557026461 141 HMPPIVNSGKPEEIECRREQINYVDPFTNHTSKYSLLVRGPSDVRKKELVFLQFSLNETKQDFSAISYLLFSSFQEFLDS 220
gi 432941237 143 YIPALVNPGKPQPGDCEFRNVTYVGPFSNGTQKHAVVVRGPSDVRNKELIFMQFSLNETQEDFSAITYMLFARFSDLTAS 222
gi 348510737 148 YIPPLVDPGKPQEVDCKMTEVTYFGPFANETEKKALVVRGPSDVHNKELIFMQFSRNETEEDFSAINYMLFAKFSDLIDS 227
gi 82187715   83 NIPPLVALENLAKRECMKEEVIYHGPYSNQTEKRALVFRGPTDVRNRELIFLQLSRNETEEDFSAISYMIFAKFSDMLES 162
gi 327262495 123 YIPPLVNPGQPGEIECLTETVNYTAPFTNETKKHAIIVEGPRDVKKRELVFMQFHLNETDQDFSAIDYLLFNSFQEFLSS 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123885948 216 HDQVKFMQDCESSFSSWKFSGGFRTWVKMSLVKTKEEDGSQSVEFRQETSVVNFIDRRETPDKGDQLFFVVFEWKDPYIQ 295
gi 81905531  214 PDKAGFMQACESAYSSWKFSGGFRTWVKMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAERSAQLFFVVFEWKDPFIQ 293
gi 573875293 210 QNKAQFMKDCEKSYSVWTFSGGFRTWVKMSLVQTSEKDGSKSVEFRQESSVVKYYDKRLESEKTNQLFFVVFEWRDPFIQ 289
gi 619534140 216 SDKAAFMMDCERNYSMWTFSGGFRTWVKMSLVRTSGRR-NESVEFRQESSVVKYIDKRPPLEQTNELFFIVFQWRDPFIQ 294
gi 557026461 221 PDKAQFMKDCERSYSVWTFSGGFRTWIKMSLIKTTEKDGSQSIEFMQESSVVKYNDRRPVLEQKNELFFIVFEWKDSFIQ 300
gi 432941237 223 ENKSEFMRDCERNYSTWTFSGGFRTWVKMSLVNTAGKN-NQGVEFRQESSVVKFNDKRQESEQTNQLFFVVFEWRDPYIQ 301
gi 348510737 228 ANKSEFMRDCERNYSMWTFSGGFRTWVKMSLLTTSGVK-NEAVEFRQESSVVKFNDKRPEAAQTDQLYFAVFEWRDPFMQ 306
gi 82187715  163 SDKAAFMMDCERNYSMWTFSGGFRTWVKMSLVRTSGRR-NESVEFRQESSVVKYIDKRPPLEQTNELFFIVFQWRDPFIQ 241
gi 327262495 203 PNKSEFMKVCESSYSSWKFSGGFRTWVKMSLVKTKEEDSRETVEFRQEISVVNYIERRTKAE-GDQLFFVVFEWKDPFIQ 281
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 123885948 296 EIQDIITANPWSMIALLCSVFLVLFKAADFAKLSVKWMIKVRRRHLKKRARELNHI 351
gi 81905531  294 KVQDIITANPWNTIALLCGAFLALFKAAEFAKLSVKWMIKIRKRYLKRRGQATNHI 349
gi 573875293 290 QVRDIITANPWNTIAILCGVFLALFKAADFAKLSVKWMIKIRKRQLKRKARELNQV 345
gi 619534140 295 QVKDIVTANPWNTIAILCGVFMALFKAADFAKLSIKWMIRIRKRHKRAKMREMNQI 350
gi 557026461 301 EVRSIVTANPWSTIGILCGVFLFLFKAADFAKLSVKWMIKIRKRQLKVKAREMNIV 356
gi 432941237 302 EIRLVVTANPWSSIAILCGVFMALFKAANFAKLTIQWIIRMRKRHLKHKSRELNSI 357
gi 348510737 307 EIRLIVTANAWSSIAILCGVFMALFKAANFAKLTIKWTIKMRKRHLRNKARELNHV 362
gi 82187715  242 QVKDIVTANPWNTIAILCGVFMALFKAADFAKLSIKWMIRIRKRHIRAKMREMNQI 297
gi 327262495 282 EVQDIVTANPWNMIALLCGVFLALFKAADFAKLSVKWMIKIRKRHLKRRSQILNHI 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap