Conserved Protein Domain Family
DUF4562

?
pfam15123: DUF4562 
Domain of unknown function (DUF4562)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. There is a conserved HRYQNPW sequence motif. This family includes the human protein C4orf45.
Statistics
?
PSSM-Id: 317532
View PSSM: pfam15123
Aligned: 19 rows
Threshold Bit Score: 170.209
Threshold Setting Gi: 156380481
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545209911   22 GPDYKKDHLPKVHRDTSYIGEKRPALEKTGDLRYLWRPASDKSFSARYKHEYVGEIGWRIPEYDFINKTRLETGFHFKYG 101
gi 821490705    9 GPDGIKDYKAKCPANTTYTGEKRPVLGATSDLNYLWRAAPKRSFAPIQKHFYVHEIGWGIPELSCINESRLTTGVNIKRG 88
gi 620946648   22 GPDGIKDYRPKIHDFTRFIGEKPPALDVTSELRYLWRPAPRNCFTPAHRSNYVGEIGWAANQLGF-HQMNLQSGKNIKLG 100
gi 612030800   23 GPEAKKDYKPKIPLYTKYIGEKSPVLETTTELDYLWRPAPNKNFIAREKHFYVGEIGWGIPALSYTNDSRLQTGWNKKQG 102
gi 971392685   59 GPDGIRDHRTRRPEHTHYIGATSPAIEGSSDAGYLWRPASCFSSPLLRRCQYAREIGWGVRELSYFTWRNLQSGAQIKRG 138
gi 972965650   24 GPDGIGDYRVRVADFPRYIGVGTLSPEGTSELDYMHRAAP-GTPAPMPKHCYVGGVGWGVQEYSALNARNLHSKMQFQLA 102
gi 198434076   39 GPDGITDQRVTVEEDNRYVGIGTMSPEGTSELAYLYRPDWRNSPAVLPKHKRVGEIGWGIPKYS--DRSYLYTGRQIKRG 116
gi 874464955   44 GPDAIRDHRTRRAEHTHYIGETSPAIEGTSDANYLWRPASCSRTPP-RRSDCPGEIGWGVRELSHFARKNLQSGAQIKRG 122
gi 1003769883  55 GPDAIRDHRTRRPEDTHYIGATSPAIEGSSDAAYLWRPAPFFPPPMYRRCQYAREIGWGVRELSCFTWRNLQSGAQIKRG 134
gi 545524943   22 GPDYIKDHVPKVHQHTSYIGEKRPVLEKTGDLRYLWRPASKRSLPAKYKYEYVGEIGWGIPKYDFISKSRLRTGFHIKYG 101
                          90       100       110
                  ....*....|....*....|....*....|..
gi 545209911  102 EVSEAAIDEISHRHQNPWQPKPCIMDALGKYS 133
gi 821490705   89 EFRKRVEEIISHRYQNPWYPKPQILDLQGPGS 120
gi 620946648  101 EFRNASEKRATHRYQNPWQPKPEILDQQGAGS 132
gi 612030800  103 EFHKAAEDLLSHRYQNPWYPNPQILDLQGAsr 134
gi 971392685  139 QIWQAAEDEATHRYQNPWQPAPWVLEHQGRGA 170
gi 972965650  103 EFRQACEERVTHSYQNPWQPPPRVLNEQSAGA 134
gi 198434076  117 EFRQSAEDRHTHLYQNPWTPKPQYNKTkrprt 148
gi 874464955  123 LIWQAAEDQATHRYQSPWQPAPYILEQQGHGA 154
gi 1003769883 135 QIWQAAEDQATHRYQNPWQPAPWVLDYQGPGA 166
gi 545524943  102 EISQATIDKISHRYQNPWQPKPYIMDMQGKYS 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap