Conserved Protein Domain Family
FAM150

?
pfam15129: FAM150 
FAM150 family
This family of proteins known as FAM150 is found in eukaryotes. Members of this family are as yet uncharacterized. Proteins in this family are approximately 143 amino acids in length. The function of this family has not, as yet, been determined, however it is predicted to be a secretory protein family.
Statistics
?
PSSM-Id: 317537
View PSSM: pfam15129
Aligned: 15 rows
Threshold Bit Score: 138.315
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82256855    35 RTLLDLILQ---VIRDSQ--QREKN--TSRRCIAGLLTSAQDMKLSSPE----KPFYiprlDNSRLIEIFPRDLNMKGKF 103
10_pfamImport   3 RTLLDLILQ---VIKDSQ--QRDKP--VSRRCGSGLHTSAQDFKSSSRE----KPLYvprlDNTRLIDIVSRDADLKNKF 71
13_pfamImport   3 RTLLDLIMQ---VIGDNQ---GDKS--VSRRYTSGLYSVDQDYKFSSRE----KALFfprlDNSRPIEIVPRDVNLKDKF 70
12_pfamImport   1 SSLLELLMDssrAARQQQadHSSTSvqQQPQEQQQQEPPKRNYSVETTEgnevNKSY----QHDQVLEVFPRDLRQKEKF 76
11_pfamImport   3 QSLLNLIME---IIQELKryHLEKD--SGVQY-----FSKHDYNLDRREvadyGGY-----QDEQRVEIVPRDLRMKDKF 67
5_pfamImport    3 QNLLNLIME---ILQELKrvRLEED--EENGV-----QYKHDYLLGRRQlpdyAAD-----SEEQRVEIVPRDLRMKDKF 67
14_pfamImport   2 QALLKLIMD---TVKHLKkhHTEQN-----ENIVQYISKHSDYSLDPKEqqhiDKSYhedhHEDHIVEIFPRDLRTKEKF 73
1_pfamImport    2 EKTLRRIME---IMRQVE--NSADD--ESAQK--------TESAPEPKDthhlKTA-----SGETILEIFPRDLSRKEKF 61
2_pfamImport    3 TSLLELLMD---RVRQTQehHSEGNtqHPPQII--------EHSLETKDvnkvTKSY----QHERILEVFPRDLRQKDKF 67
gi 542232803   43 QQDLRRMVE---IVKQVE--GSRGR--HSAKTEAPAISRETSSPMEQKDfrdlKAF-----RGNQAVAIFPRDLRKKEKF 110
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 82256855   104 IQHFTaGPVKFSSECRIQFHRLYHNTRDCSRPAYYKRCARLLTRLAMSPLCMQ 156
10_pfamImport  72 IQHFG-GHVKFSSECKTHFHRLYYTTRDCSTPAYYKRCARLLTRLAMSPLCMQ 123
13_pfamImport  71 IKHFTaGPVKFSSECRTHFHRLYHNTRDCSTPAYYKRCARLLTRLAMSPLCTQ 123
12_pfamImport  77 LKHLT-GPLYFSPKCSKHFYRLYHNTRDCTIPAYYKRCARLLTRLAGSQRCSE 128
11_pfamImport  68 LKHLT-GPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCME 119
5_pfamImport   68 LNHLT-GHLYFGPKCTKHFHRLYHHTRDCTTPAYYKRCARLLTRLAVSPMCME 119
14_pfamImport  74 LKHLT-GPLTVSPKCSKHFYRLYHNTRDCTIPAYYRRCARLLTRLAGSSRCME 125
1_pfamImport   62 ITILT-GPLYFGPKCKKDVYRLYHNTRDCTIPA-------------------- 93
2_pfamImport   68 LKHLT-GPLYFSPKCSKLFYKLYNNTRDCTIPAYYKRCARLLTRLAGSQRCTE 119
gi 542232803  111 IKYLT-GPLSFSPKCRKSVYKLYHHTRDCTIPAYFKRCARLLTRLAGSPQCTE 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap