Conserved Protein Domain Family
DUF4568

?
pfam15132: DUF4568 
Domain of unknown function (DUF4568)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes.
Statistics
?
PSSM-Id: 317538
View PSSM: pfam15132
Aligned: 5 rows
Threshold Bit Score: 304.868
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905919    3 GagLQAWLYP------GRVRFRPLERMCASRV-SSGLRTVPQEYACCQCYTKFGGHLPVPRADALLPYWVPLSLRPRKQV 75
3_pfamImport   1 GvsHQAWMYPdsqglwSRTVCLRLAEVCLKQM-CPVPSTVHRESICCECHTRFGGHLPVPRAEAALPYWVPLSLRPQKQI 79
1_pfamImport   1 G--RKRWGFR------GRGRSRGLTGRCEGRArRGVTRTVHLEPICCECQAKFGGYLPVPRAKAALPYWVPRSLRPQNQI 72
2_pfamImport   1 GcgWKVWPWQ------GRAHFKPLGKKSVGKM-CPVPSTVHQEPICCECQAKCRGYLPVPRFEATLPYWVPLSLRPRKQI 73
4_pfamImport   1 -------FFL------GRAHFKPLGKKCASQIlC----AVHREPLCCEYQPRFGGRLPVPRAEAALPYWVPLSLRPQKQI 63
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905919   76 SKMMRCYIPRAMKSCRCSCHCFGGRLPMPRDRAVMPYWVPQGLRSQKKVLKRLENVEDTPGRPQDSSRWYgcWRVCGNQH 155
3_pfamImport  80 QKMVRFYVLKSTKACRCPCHCFGGRLPMPRDQATMPYWVPQVLRSQKKVVKRQQHLKDIPEATVDLRSGY--WQICGEGG 157
1_pfamImport  73 QKMVRSYIPKTTKACPCPCHRFGGHLPMPRDQAVMPYWVPQVLRSHKKVVKRQQSFKGVPEAPLDVRSGYnrWRICGEGR 152
2_pfamImport  74 QKMVQFNIPKTSEACPCPCHRFGGRLPMPRDQAVMPYWVPQVLRPHKKVVKRQQSFTGIQEPALGLRSWYnrWRICCDGH 153
4_pfamImport  64 QKMVQTDIPKATKACPCPDHHSGGYLPMPRDQAVMPYWVPRVLRSCKKVVKRQQSFKSIKESPLDSHSWHhrWRICCSRH 143
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 81905919  156 LLLKWQQLQALYQDElpGLQEDEPHAGRLGLLPISFNLLSLLQAVLRAIIAICHLFWD 213
3_pfamImport 158 RLLKWQQLRALHQPK--PVAPGQPASLLAPLLPLSLSLLTFLQALLRVIVAIRRSFWP 213
1_pfamImport 153 HLLKWQQLQALHQAG--PVASGQPESPPASLLPLNLSLLTLLHALLRVMEAIRQLFWV 208
2_pfamImport 154 LLLKWQQLQALHQHE--PLAPGKGASIPAPLLP--RSLLTLLQAVLRVVVAIRQLFWV 207
4_pfamImport 144 LLLKWLQLQALHQEG--QLAPERRVIPQPSFLPLCLSFLAFLQAVLRAISFIR----- 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap