Conserved Protein Domain Family
DUF4570

?
pfam15134: DUF4570 
Domain of unknown function (DUF4570)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes.
Statistics
?
PSSM-Id: 317540
View PSSM: pfam15134
Aligned: 17 rows
Threshold Bit Score: 101.665
Threshold Setting Gi: 82258572
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82258572    1 MCSSTQNEIKLVDTYEEILRQRAELLELMEERRRQRDE-QRRRQQEASQAARRRNEQLLQDLRRLEEEVRGQ--QLPRPH 77
gi 821470118 122 gMAYFAKEVRLTKKHEEILAQRLLLLQEMENDHIGQKTeKKASHIKAAKLAYKRNKSLLNDIRTLEEKLEKKlhLRSYPE 201
gi 972971173   1 MALYLTQEIELSRRHEEILSRRAALLQQMEDRYEKQKR-KKQAYAVLSDGARERNAKILKDLQALEDRLSAR--PLPHPD 77
gi 556994349   1 MASYLAQEVELSRRHEEILAQRVALLQQVESQLEDQKN-GKKLKAEESEAAHKRNVVLLHDLEKAEETLSVQarMLPHPD 79
gi 612041664  44 MMSYFAKEVQLTKKHEEILAQRLLLLQEMENDHGNQKTgKKTSHVKAAKLAQKRNRSLLQDIRTLEKRFEKEahSRPPPE 123
gi 260831934   7 eeKWLAREIQLSQKHAELLAKREQLLHLSQSELNSSEHrAKVHQAHWTH-VQQRNKQLLQDIKRSQVEMKDIarQPPNVK 85
gi 528494134   1 MASYTVEEFELSQKHEDILGKRALLLQQMEAHYEQQRA-KRKQQFLMCQAAKQRNAQILKDLENVEKNLQTR--QLLHPN 77
gi 597732898   1 MASNLNEEVELSKKHEEILGRRAVLLQQMEICYEQQKA-KKKQQAMASQAAHERNMKILEDFQKLENCLQTR--PLLHPD 77
gi 565322706   1 MASYLAQEIQLAKQHEEILSRRSVLLQQMESHLRDKDA-EQAWHTQEAGAAHKRNVSLLNDIEAAAKNLQSRehLLLHPE 79
gi 327277756   1 MASYLAREVQLAKRHDEILSQRLVLLQQMESHRGDKEA-EKTWQMQEADAAHKRNVVLLADIEAAEKKLHSRehLLLHPD 79
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 82258572   78 LQALESRYWAF--RQTPRsfgsapvgWKVNLQPMERKH 113
gi 821470118 202 MVNLQTLYWALveEQAPK--------WEQFLLGRTQYl 231
gi 972971173  78 IVNLETQYWTSveEKVPE--------WEQFLLGKVhsf 107
gi 556994349  80 TVKLETRYWASveEKLPK--------WEQFLLGKAlsl 109
gi 612041664 124 LTNLQILYWALveKQAPK--------WEQALLGRARRP 153
gi 260831934  86 FTELQN--CPEseGVVPA--------FPPVCLPRRPGP 113
gi 528494134  78 IISLETRYWASveRNLPE--------WEQYLLGKGQPP 107
gi 597732898  78 VINLQTRYWASveQKLPE--------WENYLLGKGPAP 107
gi 565322706  80 IVNLETLYWAKveESIPK--------WEPFFLGRTQAP 109
gi 327277756  80 IVNLETLYWAKveEAIPN--------WEPFFLGKTQAP 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap