Conserved Protein Domain Family
Syncollin

?
pfam15138: Syncollin 
Syncollin
This family has a role in zymogen granule exocytosis.
Statistics
?
PSSM-Id: 317544
View PSSM: pfam15138
Aligned: 12 rows
Threshold Bit Score: 195.321
Threshold Setting Gi: 573879111
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158937234   22 ACPVPADLK--KSDGTRTCARLYENSDPYYDNCCQGPELSVDPGTDLPYLPSDWSNSASSLVVAQRCELTVWSLPGKRGK 99
gi 637365239   53 QCPVPADLK--REDGTKACALLYTENSPYYDQCCAGNVMEVEPGEDQPYMPSGFNNKVSSVVVAQRCELNVWSSKAKGGK 130
gi 20806121    33 ACPVPADLK--KSDGTRTCARLYENSDPYYDNCCQGPELSVDPGTDLPYLPSDWSNSASSLVVAQRCELTVWSLPGKRGK 110
gi 301622156   19 lcPLPADLK--DIEGNKLCARLYEHSSPYYDQCCEGDYIDVKPGDDVPYLHLKWNNRISSIVVGTRCELTVWSRKPKEGY 96
gi 597781377   20 QCPEANALY--DLEGTKLCARLYAQSNIYYDQSCQGDYLDIYPNDDVPTIAWRWNNRASALVVSRLCNLTVWSRIRKEGT 97
gi 967497850   24 ACPASADLK--HSDGTRTCAKLYDKSDPYYENCCRGAELSLEPGADLHYLPSNWANTASSLVVAPRCELVVWSRQGKAGK 101
gi 558160686   22 ACPAAADLK--NPNGTRICAKFYDKSDPYYENCCQGAELTIETDTDLPFLPYDWRNIISSLVVAPRCELTVWSRNGKGGK 99
gi 573879111   20 QCPDPATLK--DSSGAKLCARMFEDSNYYYDQSCGGSYLDIYPGDDFPLIPPAWNNRASSLVVSKFCSLTVWSRGKKQGK 97
gi 1040675611  20 ACPDHATLK--DDHGSKLCAQMFEHSSYYYDESCTGSFLNVYPDEDTPIMPKTWENHVSSLVVRRGCSLTVWSKSKKKGN 97
gi 163915177   19 ECPNSALLL--NESGEKLCARMFEHSSAYFDQSCGGAYLDAKNGDDFPYMPSGWKNKISSLVVSSRCTLKVWSKEGKLGN 96
gi 311271959   24 ACPAPADLK--NEDGTRTCAKLYDKSDPYYDNCCGGAELSVQPGTDLPYLPSDWTNVISSLVVAQRCELTVWSIRGKAGN 101
gi 565307726   21 QCPAPNELKnpNPNGTKVCAQMYTDNSPYYDLCCSGSLLMVLAGEDQPYMPTAFNNKVSSLVVGQRCELTVWYRKGKGGS 100
                          90       100       110
                  ....*....|....*....|....*....|....
gi 158937234  100 TRKFSTGSYPRLEEYRKGIFGTWAKSISGLYCKC 133
gi 637365239  131 TRKFKAGAFPRLQEYRRGIFGDWNNAISGYYCTC 164
gi 20806121   111 TRKFSTGSYPRLEEYRKGIFGTWAKSISGLYCKC 144
gi 301622156   97 TKKFTAGAQPRLKEVKKGLVGDWDDSISSYYCKC 130
gi 597781377   98 KRKFSPGIQYRLKDVQKGLFGNWDNSISGYYCTC 131
gi 967497850  102 THKFSAGTYPRLEEYRLGILGNWSNAISALHCRC 135
gi 558160686  100 TRKFKTGTYPRLEEYRRGIFGHWSNAISSIYCRC 133
gi 573879111   98 KRKFSSGTYYQLKEVGQGLFGNWNNDISGYYCVC 131
gi 1040675611  98 KRKFLAGVVYHLKEVKRGLFGNWNDAISGFYCTC 131
gi 163915177   97 NRSFSAGTVYQMKDYKNGLFGNWNDSVQAYFCTC 130
gi 311271959  102 THKFSAGSYPRLEEYRRGIFGDWSNSISSLYCSC 135
gi 565307726  101 TRKFKAGAYPRLQEFKRALFSNWDDSISAYYCKC 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap