Conserved Protein Domain Family
FANCAA

?
pfam15146: FANCAA 
Fanconi anemia-associated
This family of proteins plays a role in the Fanconi anemia-associated DNA damage response.
Statistics
?
PSSM-Id: 317551
View PSSM: pfam15146
Aligned: 15 rows
Threshold Bit Score: 480.724
Threshold Setting Gi: 542215631
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150403946  447 ANAGQKIKELLLDIGDVSERVSFLKKAVDQRNKAITSLNEAMNVSCALLSHPEG------D--------R------PIAC 506
gi 973136878  464 AQVGQKVRDLLAGIGNVSERVSSLKSCIHLKNDALRNLNQVFNICCLLMPNQRHagggpcPv-------R------PISC 530
gi 597793044  416 tQVGQTVKDLLAGIGNVWERASSLKHQLQVNNNVLKHLNQVINICNLLLNSQKK------Dq-------KgsdckpPISC 482
gi 551524234  416 SQVGRSVGDILSAIGDVCERASALKTIIRSKNQILKELNQVMNISFLLSNRSEF------Ds-------K------PVRC 476
gi 111599661  298 ESAGQKIKELLSGIGNISERVSFLKKAVDQRNKALTSLNEAMNVSCALLSSGTG------P--------R------PISC 357
gi 971424631  454 AEAGRRIKALLSGIGNTSERVSFLKKAVDQKNRALASLNQVMNVSAALLSGQEG------Q--------K------PIAC 513
gi 327264576  437 DKAGQRIKELLSGIGHVSERVSSLKKAVDQKNQALTCLNQVMSVSAALLSSQNG------Q--------K------PITC 496
gi 1040659917 313 SLAGQRVKDLLASIGNVWERAESLKQKLQEKNESLKQLNQVLNICSLLLESNGK------EkqsnmdtkP------LISC 380
gi 542215631  426 tQVGRSVRDLLSAIGDVCERASVLKTVIKSKNQFLRLLNHAVSISFLLMADTNT------Dlpi---keK------PIRC 490
gi 301621609  427 SQAGQRIKELLSQIASVSERASPLKSLIEQRNHSLLNLNKVVAISQAVLTSRGA------N--------M------PVRC 486
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150403946  507 TITTSWSRLELRDMLMATCTLENSSSFSLDQGWTLCIQVLTSSSALDLDGTGSAFTYTIPVDRLGPGSRREVTLPLGPSe 586
gi 973136878  531 RVRVKRSCILQQETLFLSCVLQNSSDYILEQGWTLCVQLIYPPYPLTAQGERPTKTYSFPFDKLHPGKNLEVTLPLATE- 609
gi 597793044  483 HGTAKWSTLLQKDTLVLTCSLENSSNSALEEGWTLCVEI---ESPHSLRAEGSSRTYSFALKKLDWGQKVDVSVPLDVG- 558
gi 551524234  477 RGLVRWSSLLQRDSLNMTCVLENLSPFVLERGWTLSVTVRPLSCPLEAGGNASSVNYSFPFGGLGPGESVEVSLPVAAE- 555
gi 111599661  358 TTSTTWSRLQTQDVLMATCVLENSSSFSLDQGWTLCIQVLTSSCALDLDSACSAITYTIPVDQLGPGARREVTLPLGPGe 437
gi 971424631  514 TVTANWSCLLLRDTVTISCLLENCSEYSLEQGWTLCVQLLASPCALEEESVDSATTFTFPIDQLLPGTKRELTLPLSSAa 593
gi 327264576  497 TITVHWSHILVQDTLTVSCILENLSECSLERGWTFCVQLFAGSCDFDEGSSDSATTYTFPIDQLLPGNKTEVTLPLGPTe 576
gi 1040659917 381 HGAARWSSLLQKTSLTLTCVLENSSGCTLEHGWTLCFQV--HSFYQHPNTESASSSYSFPLRKLDSGQKLDVTIPLESN- 457
gi 542215631  491 YAETSWSRLLQKDSLNLVCFLHNSSPFVLERGWTLSITVSPLSCSSSPAGESSSTNSSFPFHDLCPGETFEASLPIAAA- 569
gi 301621609  487 KVKPLWTRRLQQDCLVASCILENKTDFILESGWNLCIHL---------STEGSGTSYSFSVMNLQPEENMEFIFPLVTEe 557
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150403946  587 sGVLDLPVTMSCWLFYSLREVVGAALAPSDPLEAPYLEqf-pLSLPKQEGVCLPLCKRTVDMLQCLRFAGAATHPAQAP- 664
gi 973136878  610 -SELALPVTVCCSLMYFLQSILGEEECRWAPMSQPSLS----QLVKDSGYISLVLDTQTVDWLDCLWVGGPATHGNNTR- 683
gi 597793044  559 -AELFLPVKIHCFLVFSLQSLLHSKESSGDPV-----S----QHLADKGCISLALNTLTLDWIDSLRIGEPASHGEI--- 625
gi 551524234  556 -GDASFPVTVTCSLLFSLWKFLGQEEAAAP-------------LDSQRACFSLPLNTLTVDWLHALRLGDLPAP----P- 616
gi 111599661  438 nGGLDLPVTVSCTLFYSLREVVGGALAPSDS-EDPFLDecpsDVLPEQEGVCLPLSRHTVDMLQCLRFPGLAPPHTRAP- 515
gi 971424631  594 dTKLDLPLTISCALYYSLRDILGSGSDSPEALDDLLPDds-pILSPDREGICLPLSECTIDMLQCLRFESSTPRPDASPk 672
gi 327264576  577 gTKLELPFIVSCSLYYSLQEILGTVSESTELLDDLFSDds-pGLCPDREGICLPLKEATIDLLQCLRLKNGSSTSDGGPp 655
gi 1040659917 458 -GGLFLPVKVCCSLSFSLCALFGPEASSPGVF----------QLLKEAGSISATLNTLTVDWLDALRLEGSFSPND---- 522
gi 542215631  570 -GDASFPMTVSCSLIFSLSSLLGEEEVAAS------------FAGLQSSCVSLPLSTLTVDWLHALQLNSPIATHKMATv 636
gi 301621609  558 sEHLEFPIKITFALVYSLQEL------DKSSFQDPQSS----LFSHTQSSICLPLQEHIIDILQCLRL---KPHTGQPFp 624
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150403946  665 --CMPGPACEPVETFLKTCQ-------APGSEPT---GAAs---lRAKYLPPSTASIRVSAGLLRAALEDS-H-SG---- 723
gi 973136878  684 --PSSGSGVDLVQTLLTSSRkaqqqecEGAPLKT---LPQ-----RSSEGGPFVASLRVSSDLLKTALQLS-G-SG---- 747
gi 597793044  626 --PEQNTAWKATHFFLSSRR-------ICMKEQP---MPQs---------GPHVVAIQISSELLKTWLGFHdC-ST---- 679
gi 551524234  617 --RSSSNPADLIQGFISSRQlrc----rgGGQAS---RPEe-----------YSARVRVSSELLRDALGLT-P-GG---- 670
gi 111599661  516 --SPLGPTRDPVATFLETCR-------EPGSQPA---GPAs---lRAEYLPPSVASIKVSAELLRAALKDG-H-SG---- 574
gi 971424631  673 aaSLPAPQ-DPVETFLKASKeqpepeaGTASE-----QPCa---tGEGGMPPSAASIRVSSELLKNALKTS-G-SD---- 737
gi 327264576  656 aaAMPLPG-DPLDTFLKLSQmrsdldgIERSDEV---VPRalntlGEDYLTPSVASIKVSSELLRTALKDF-C-AD---- 725
gi 1040659917 523 --IRCNTVSEGIQAFLRSRGvstkhldNISNP------------------GPVAVVVSVSIELLKSKLHLS-TtSS---- 577
gi 542215631  637 --QPCSAAADSIQTFLSSRQlrcsgrtDRGGESVpkpEPEk-----------YSASVRVSSELVRDTLKPQ-KsSNldtk 702
gi 301621609  625 ttFHCMSPLDPVEAFLRSSGga---ecKPGQPSA---ISKaicnaESNYAVTLVASVRVASVILHRALKKE-D-SD---- 692
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150403946  724 ------FHLCSATLRWLLAENAAVDVVRAQTL------SSIQGIAPDGTDVNLTVHEVAVTDLSPAGPIQAVEIQVESSS 791
gi 973136878  748 ------PSVSSAVLHWLVSCSPAGENIACEDI------PVLSAVCPGGASLRLLAQEVTASDLWADGPITAVEIRIESSS 815
gi 597793044  680 ------AALCISVLRWLISGTSEAKGQNLVQG------PVLCARGLDGQPVRLLTKEVILSDVNSEGPLSAVEVQMESSS 747
gi 551524234  671 ------P--HVSLLEWLLSEGCGGVKAERKGIktdggsSVICGSAPNNAAVKLTAEEVNIEE--KTEPLVTMEVQVKSSS 740
gi 111599661  575 ------VPLCCATLQWLLAENAAVDVVRARAL------SSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSS 642
gi 971424631  738 ------VPLSCATLRWLLAENAAATTLSSEEV------TSVCGAAPDGGEVQLIIREVAMNDLSPAGPIQAVEILMESPS 805
gi 327264576  726 ------VPLCCAVLRWLLAENVEADALRSQER------MEVWGLAPDGGEVQLNIREVAVSDMNTAGPLQAVEIVIQSSP 793
gi 1040659917 578 ------LESSMSVLNWLVSPEKIGSVKS----------PVVNAYSPDGCSVKIMAKEVTLGDFYSEGPLEALEIRVESSS 641
gi 542215631  703 esmrnpEDLCLSLLERLLSEDTEGVKMGYQGDkialstSVVHARGPNGAAVKLTAKEINVGEEESTDKEATIEVQIESSS 782
gi 301621609  693 ------TSLCSLLFHWLLS----AELPLSQNP------VEVHGMTPNGREFRLRVGEVSAYDLSPANPIPATEVQIISPH 756
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150403946  792 LANMCRAHHAIIRRIQTMVTEQAALGSSPPDLRMQYLQQIHANHQELLREVQALRDQLCTEDELS-ScSTAQKLLHIYKQ 870
gi 973136878  816 LAELCGLHFAVLRRLQALLKEGVPEAGAARRLKGQSFVQLLQHTETLSKAVQEARGHIALGLGMS-S-RITEKLLHTYGQ 893
gi 597793044  748 MSAVCGLHHAVLRRVQGLLQDASVKSVSPAHLRGQYLCETIRHAESLYKDLQDSRASAAFGGVIK----TRTSLFPLYLE 823
gi 551524234  741 VAAVCGLHHAVLHRIQTLLQ----KAGSSRTVPIADLRLALQQAE-----VERGQVWEASSVGVS-SgQMQTLLLRVYQQ 810
gi 111599661  643 LADICRAHHAVVGRMQTMVTEQAAQGSSAPDLRVQYLRQIHANHETLLREVQTLRDRLCTEDEAS-ScATAQRLLQVYRQ 721
gi 971424631  806 LAHTCRMHHAVIRRMQALVLEQAAQGSGPPDLRMQYLRQIQTNHEMLLKEAQSLRDHSPL------TkEDTEKLLHIYQQ 879
gi 327264576  794 LANMCQLHHAVVRRIQALVLEQAAQDSSPPDIRVQYLQQIQANHEMLLKEAQSLRDQLCLDND---SdATVEKLLHVYRQ 870
gi 1040659917 642 VAAVCGLHHAILRRLLDLLRDSSAQYSHTRNLKAQSLCEAVRHVESLYKDLQDAQNKAALGGEMK-TsQRSDVLFHIFQE 720
gi 542215631  783 LPVVCGLHHAVLCRIQTLLQSATEKAASTKNVQILGLRRALQRAE-----IQQSRISGAFGEVVS-TvQRDRMLLSVYQE 856
gi 301621609  757 LDALACLHLAVIRRLQILAEKCNQDGCISPEINLDSIQKQVIARESLLKEVKSLLDNLCVRKDLSfEsSAKKRLLCLYKE 836

                  ....*....
gi 150403946  871 LRNPSLVLL 879
gi 973136878  894 LRDSPFLIL 902
gi 597793044  824 LRKHPLLIL 832
gi 551524234  811 LRDGPLLML 819
gi 111599661  722 LRHPSLILL 730
gi 971424631  880 LRNPSLVLL 888
gi 327264576  871 LRNPSLIVL 879
gi 1040659917 721 LRTNPLVIL 729
gi 542215631  857 LRQNPLLIv 865
gi 301621609  837 LRDPGLLLL 845
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap