Conserved Protein Domain Family
MRFAP1

?
pfam15155: MRFAP1 
MORF4 family-associated protein1
This family of proteins is found in eukaryotes. Proteins in this family are typically between and 127 amino acids in length.
Statistics
?
PSSM-Id: 317559
View PSSM: pfam15155
Aligned: 3 rows
Threshold Bit Score: 124.709
Threshold Setting Gi: 821028552
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545493712   1 MRPLDivelaepeEVEVLEPEEDFEQFLLPVINEMREDIAALTREHGRAYMRNRSKLWEMDNMLIQIKTQVEASEESALN 80
gi 821028552   1 MRPVD--------ADEAREPREDPGSPLSPAPRAGRENLASLERERARAHWRARRKLLEIQSLLDAIKSEVEAEERGARA 72
gi 562849887   1 MRPLD--------ADGAQEP-EDPGGLLSPVLRVVREDVACLEREHVRAHWRARRKLMEIESLLDEIKSEVEASEASALD 71
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 545493712  81 HLQNPGDAVDGRAAKRGEKADEKAKEIAKMAEMLVELVRRIERSESS 127
gi 821028552  73 PAPSPRAEAEERVARLCAEAERKAAEAARMGRRIVELHQRIAGCECC 119
gi 562849887  72 PARSPGLDAEERVVKLCAKVERKAVEAARMGKRILELHQQMDSC-AC 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap