Conserved Protein Domain Family
IQCJ-SCHIP1

?
pfam15157: IQCJ-SCHIP1 
Fusion protein IQCJ-SCHIP1 with IQ-like motif
This is a family of eukaryotic fusion proteins. It bridges two adjacent genes that encode distinct proteins, IQCJ, a novel IQ motif containing protein and SCHIP1, a schwannomin interacting protein. It contains a unique calmodulin-binding IQ motif at the N-terminus not shared with its shorter isoform SCHIP1, suggesting a distinctive function for this protein. It is localized to cytoplasm and actin-rich regions, and in differentiated PC12 cells is seen in neurite extensions. the exact physiological function is unclear.
Statistics
?
PSSM-Id: 317561
View PSSM: pfam15157
Aligned: 2 rows
Threshold Bit Score: 263.134
Threshold Setting Gi: 586999989
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586999989  91 EEMKRLQNPLEQVNDGKYLLENHQMAMDMENNIEKYHLNLQPLESKVKIIQRAWREYLQRQDPLEKRSPSPSSVSSEKLS 170
gi 675795472   4 EELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKRSPSPPSVSSEKLS 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586999989 171 SSVSMNTFSDSSTPvSAMFPFYGLTGQ-SFDRQVF-----DSKkgisrfmdskgeqqvefvavqktvaedlfladsrkqi 244
gi 675795472  84 SSVSMNTFSDSSTP-FARAPFGKIHPYiSWRLQSPgdklpGGR------------------------------------- 125
                        170       180       190
                 ....*....|....*....|....*....|...
gi 586999989 245 vnlKVTVLHLDQLTRATGFIYTLREFQIGRLGF 277
gi 675795472 126 ---KVILLYLDQLARPTGFIHTLKEPQIERLGF 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap