Conserved Protein Domain Family
Meiosis_expr

?
pfam15163: Meiosis_expr 
Meiosis-expressed
This family of proteins is essential for spermiogenesis.
Statistics
?
PSSM-Id: 317567
View PSSM: pfam15163
Aligned: 8 rows
Threshold Bit Score: 111.396
Threshold Setting Gi: 301109425
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 166233658  13 VSRPKHWSEEVEEAYRFQCAGYRDAIEYSDIKQ-KEPERWPHNGYVKKLQ-RKDGCFVYFDKTRECQDKDVNKTKMY 87
gi 166233816  16 MSRAKQWTGEVENLYRFQQAGYRDELEYRQIKQ-AEIDRWPDTGFVKKLQ-RRDNTFYYYNRKRECEDREVHKVKVY 90
gi 301109425  61 CYRPKEWSPEAEEAFRVQQTGWRDIKEYMETYG--EPERW-QNGFVRCTRvKANGYYTYWRPHRECDDKYLHTVKLF 134
gi 313228817  33 VSRAKLWDEEVEDNFRFQAAQYRDEVEFKAVNPnQDVCRWP-SGMIKKIR-RKDGTWNYFNKDRECY-KNLHLVKMY 106
gi 823453768  18 MHRAKIWSNDVENLYRFQQAGYRDEVEYKQVKQvDKVECWPETGFVKKLQ-RRDNTFYYYNRQRECEDKDVCKVKVY 93
gi 115733012  12 MTRPKRWSEEVEENYRFQLAGYRDAVEYTSIKK-DEPNRWPETGYVKKLQ-RKDGLYYYYNRSRECEDKDVHRTKMY 86
gi 762083020  18 MVRATSWSDDVEEAYRFQLAGYRDAQDYVVCNK-AEADRWPHNGYIKKLI-RKDGCWYYFNKSRECSDKDVPKCKLY 92
gi 260781237   6 MTRAKKWDEVVENAYRFQLAGYRDEEEYRSVKQvDSAEKW-DNGFVKKLQ-RKDGCFYYYNKARECSDKDVPKTKLY 80
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap