Conserved Protein Domain Family
WBS28

?
pfam15164: WBS28 
Williams-Beuren syndrome chromosomal region 28 protein homolog
WBS28 is an integral membrane family. These proteins have been identified as being linked to Williams-Beuren syndrome, OMIM:194050. This family of proteins is found in eukaryotes, and are typically 266 amino acids in length.
Statistics
?
PSSM-Id: 317568
View PSSM: pfam15164
Aligned: 12 rows
Threshold Bit Score: 311.357
Threshold Setting Gi: 395537055
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160221324   1 MEALPPVRSSLLGILLQVTRLSVLLVQNRDHLYNFLLLKINLFNHWVSGLAQEARGSCNWQAHLPLGA-AACPLGQAlwa 79
gi 291411466   1 MEVVPPVRPSLLGVLLQVLRLSVLLVQNRAHLYKFLLIKITLFNDWVSGLAQEARGDSGRQPRPPPGV-LACPLGRV--- 76
gi 109495643   1 MEAAPRVRFGLPRILLQVGKLSALLIQNRIHLYQFLLLKMAIFQHWVSGLAQEARGSGSDQACLLPEViITYALGLVlra 80
gi 532085730   1 MEAVPPVRSSLLGILMQVVRLSVLLVQNRVHLYSFLLLKISLFRHWVSGLAQEAQGSCSPQAHPPTGI-ASCPLVRAlra 79
gi 395537055   5 VR----VRSSILGIVLQTVRISVLLFQNRIHLYNFLLLKIFLFNHWVSGLAQEAEGLTPLPAHSC----LFCPLGSAmra 76
gi 395843012   1 MEATPPVRSSLWGILLQVMRLSVLLVQNRVHLYNFLLLKIVLFNHWVLGLAQEAQGSISRQAHLAPGN-TACPLGRAira 79
gi 149756073   1 MEVVPPVRSSLWGILRLLAKLCVLLVQNRAHLYNFLLLKIVLFNHWLSGLAQEAQGSCGQQAYPPTPVfTACPMARVlra 80
gi 345801227   1 MEAVPPVRSSLLEILLLVVKLSVLLVQNRVHLYNFLLLKILLFNHWLSGLAQEAWGSCSGQVHPPAGL-AASPLGRLlra 79
gi 301769433   1 MEPVPPVRSNLLGILLLVVKLSVLLVQNRVHLYNLFLLKILLFNRWLSGLAQEAWGSRGRQAPP-----AASPLGWAlwa 75
gi 296472992   1 MEAIPLVRSSLSGTLLVVVKLSALLIQNRAHLYNFLLLKIFLFNHWLLGLTQEAQGF-----HPPSKI-AGCPVGRVlra 74
gi 311251145   1 MEAAPGVRSSLWGTLLVVLKLSVLLVQNRVHLYNFLLLKTTLFNRWLSGLSQEAQGS-----HPPANI-TACPVGRAlra 74
gi 344289933   1 MEAVPPARPRLLGILLQVVRLSVLLIQNRAHLYNLLLLKIILFNHWVSGLAQEA--------HPPPGA-AVCPVGRAlra 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160221324  80 glaLIQVPVWLVLQGPRLMWAGMWG--------STKGLGLALlsa--weQLGLSVAIWTDLFLSCLHGLMLVALLLVVVT 149
gi 291411466  77 ---LMWVPMWLLLWGPRLAWAAVLG--------CVRTLGLSLq------RLGLSVATWGDLLLSCLHSLMLVALLLVLLT 139
gi 109495643  81 glaLLWVPMWLLLWGPRLSYRVGLC--------CTHTMKLALghlcawePPGLSPATFRDLFLSCLHRLMLVALLVLLLT 152
gi 532085730  80 glaLLWVPMWLLLWGPRLVCEAVLD--------SARTLGLTLqrlgagtWLGLSVDTWGQLFLSCLHSLMLAALLLLLLT 151
gi 395537055  77 lvtLWYV---LLFRLPRLVLVHMLNsplilchlCQAACG----------YLGLFFGTWKKLLHYWFQSLLLGVLLVLLVT 143
gi 395843012  80 glvLVQVPVWLVLRGSRLVWAGVLG--------CAWAWGLALlga--weQLGLSVAIWTDLLLSCLHGLMLVALLLLLLT 149
gi 149756073  81 glaLMEVPVQLVLRAPRLVWAGMLG--------CARAFSLALkrlgaweWLGLSVATWMDLLLSCLHSLMLVVLLLLLLT 152
gi 345801227  80 glvLMEVPMWLGLRGPRLMGAAVLR--------CARALGLAPk------WLGLSAATCMDLLLSCLHGLMLAVLLLSVLT 145
gi 301769433  76 glgLLRVPVWLGLQAPQLAWAGMRH--------CARALGLAPk------WLGLSVATCTDLLLSGLHGLMLAGLLLSLLT 141
gi 296472992  75 gltLLEVPVCLALRVPRLVWAGLLG--------CARALGLGPkwlgaweQLGLSAATWTDLFLSCLHSLMLAALLLLLLV 146
gi 311251145  75 glaLIEVPGGLVLRAPKLAWAGMLG--------WARALGMAPkrlgaweQLGLSAATWTDVLLSCVHSLMLAALLLLLLI 146
gi 344289933  72 glaLIEIPVWLVLWVPRLVWGSVLG--------CARASGLSPwcldaweQLGLSVATWMDLLMSCLHSLMLVALLVLLLV 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160221324 150 WRVCQKSHC-FRLGRQLsKALQVNCVVRKLLvqlRRLYWWVETMTALTSWHLAYLITWTTCLASHLLQAAFEHTTQLAEA 228
gi 291411466 140 WRLFQKAHR-CSLGWLPgQVLLGNHAVLELL---RRLSWWVESTTALASWHLAYLVTWTTCLASHLLQAAFEHTAQLARA 215
gi 109495643 153 WKLLQKAHH-SSLGWLHsQ----SSMLLEALallRRLYLWVEHRTTLTSWNLAYLVTWTTCLASHLLQAAFEHTAQLAQA 227
gi 532085730 152 WRLFQKAHR-FSLGWLPsQ----NCAVLEL----RRLYRWVESTVALTSWHLAYLVTWTTCLASYLLQAAFEHTAQLAEA 222
gi 395537055 144 WRLCQTVHR-FGVKQLKrLALLDNRFSLEFLgllRQLYWHVESTAALTSWHLAYVVTWATCLASHMLQAAFEHTAQLAQT 222
gi 395843012 150 WRLCQKVQR-----WLPsKALQENQAVQELLmllRRLYWWVESTMALTSWHLAYLVTWITCLASHLLQAAFEHTSQMAQD 224
gi 149756073 153 WKLCWKAHR-CSLGWLSsKALLENCVVLELLallKRLYWWVESTTVLTSWHLAYLVTWTTCLASHLLQAAFEHTAQLAQA 231
gi 345801227 146 WRLCRNAHR-CGLGWLLsKALLGNHVVPELLtllKRLYWWVENTTAFTSWHLAYLITWTTCLVSHLLQAAFEHTAQLAQA 224
gi 301769433 142 WRLCRRAHRlCSLGGLLsKALLDSRVVPELWalqRRLYWWVETTTALT-WHLAYLITWTTCLASHLLQAAFEHTAQLAQS 220
gi 296472992 147 WRLYQKAQC-CSLGRLPrKALLQNRVVRRSLallKSLYWWVESTAALTSWHLAYLITWTTCLASHLLQAAFEHTAQLAQA 225
gi 311251145 147 WRLCHKAQC-CGLGRLLrKALLENRVVLGLLaplKRLYWWVESLTALTSWHLAYLVTWTTCLASHLLQAAFEHTVQLAQA 225
gi 344289933 144 WRLCRVAHR-FSLGQLRsKalleNHMVLELLaplKLLYWWVESTAGLASWYLAYFVTWTTCLASHLLQGAFEHTAQLA-- 220
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 160221324 229 QEVEPQEV-SGSSLLPSLSASSDSESGTVLPEQETPRE 265
gi 291411466 216 QETQPLQA-PEPLSEPPLPKASTPEAGPVLPEPGPPGE 252
gi 109495643 228 QEVSFEET-SEPSSQFLIPESSTTESGPLPSQPETPGE 264
gi 532085730 223 QGAEPQEA-PGPLPESKLHEPSTRKAGPVLPEPGAPGE 259
gi 395537055 223 QEGEMDMM-WEDSTMGSllpeelkalde---------- 249
gi 395843012 225 QEAELQEP-LGPSLEHLLPEFLAPVAGPVLPEQETPGE 261
gi 149756073 232 QEAEPQEA-LGPLSESLFPEPLAPQAGPVLPEHGTPGE 268
gi 345801227 225 QEPEPSKG-SGPLSESPLPEPLGPEARPALPEHGIPGE 261
gi 301769433 221 QDAEPPRG-SGTLSASPLPEPLGPEAGPALPEHGTPAE 257
gi 296472992 226 QEAEPQKA-LGLSSETPPPGPPAPGARPVLPEPGTPGE 262
gi 311251145 226 QEAEPQKAsSGLLLESPLPEPLAPEAGPVLPEPGTPGE 263
gi 344289933 221 QEAEPQEA-SWILPESPLPDSLTPEAGSALPEPESPGE 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap