Conserved Protein Domain Family
TRIQK

?
pfam15168: TRIQK 
Triple QxxK/R motif-containing protein family
TRIQK member-proteins share a characteristic triple repeat of the sequence QXXK/R, as well as a hydrophobic C-terminal region. Xenopus and mouse triqk genes are broadly expressed throughout embryogenesis, and mtriqk is also generally expressed in mouse adult tissues. TRIQK proteins are localized to the endoplasmic reticulum membrane. This family is found in eukaryotes and members are typically between and 86 amino acids in length.
Statistics
?
PSSM-Id: 317570
View PSSM: pfam15168
Aligned: 8 rows
Threshold Bit Score: 92.5205
Threshold Setting Gi: 81888778
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190411547   1 MGKKDASSVKLPVDQYRKQIGK-QDYKKTKPVLRATRLKAEAKRSAPGIRDIILV---IVAVLLFLLGVYAFFYLNLSTE 76
gi 81888778    1 MGRKDSSTTKLPVDQYRKQIGK-QDYKKTKPILRATKLKAEAKKTAIGIKEVGLM---LAAILALLLAFYAFFYLRLSTN 76
gi 557016936   1 MGRKDAAASGMPIDQYRKQIGK-QDYKKNKYVLKATRLKAEAKKSAPGIRDVALI---VAAVLVFLLVCYTLFYLNLATE 76
gi 313220549   9 kgggkAQMAQPPITKYRKNIGSyQRANTNKDATRDFKTKADIRKSISVTEETKWMgsaLVGILCLLFALYGLMFYIFSKP 88
gi 198431537   1 MAKKDNLNRGSNVETYRKRIGK-QEYQRNKVAVKSVKDAADAKQSAIGIQEVLLV---LLAIFVLLASIYLMFFLSFTKE 76
gi 284520967   1 MGKKDASTSRIPVDQYRKQIGR-QDYKKNKPVLKATRLKAEAKKTAIGIKEVILI---TIAILVFLFAFYAFFFLNWTKT 76
gi 1003755157  1 MGRKDASTARTPVDQYRKQIGK-QDYKKTRPMLRATRLKAEAKKTALGVKEVALV---LAAILVLLLAFYAFFYLNISNE 76
gi 498973453   1 MGKKDASATKLPVDQYRKQIGK-QDYKKTKSVLKATRLKAEAKKNSSGFRDAFLV---IAAILFFVLCVYAFFYLNLSTE 76

                 ...
gi 190411547  77 LDL 79
gi 81888778   77 IDA 79
gi 557016936  77 Vdl 79
gi 313220549  89 QTV 91
gi 198431537     ---
gi 284520967  77 Dfg 79
gi 1003755157 77 VDL 79
gi 498973453  77 INL 79
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap