Conserved Protein Domain Family
Spexin

?
pfam15171: Spexin 
Neuropeptide secretory protein family, NPQ, spexin
Spexin, alternatively named NPQ, is a peptide hormone and is derived from a pro-hormone. This family of proteins has a role in inducing stomach wall contraction and is expressed in the submucosal layer of the mouse oesophagus and stomach. Spexin, like most peptide hormones, is a ligand for G-protein coupled receptors. Spexin is also thought to have a role in controlling arterial blood pressure as well as salt and water balance.
Statistics
?
PSSM-Id: 317573
View PSSM: pfam15171
Aligned: 6 rows
Threshold Bit Score: 106.169
Threshold Setting Gi: 884915781
Created: 18-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 678018975  27 APQRLSEKRNWTPQAMLYLKGAQGRRFLSDQSRRKELADRPPPERRNPDLELLTLPEAAALFLASLEKSQKD---EGGNF 103
gi 122133489  27 APQRLFERRNWTPQAMLYLKGAQGRRFLSDQSRRKDLSDRPPLERRSPNSQQLTLPEAAAVLLAFLQKPQEA---GDENL 103
gi 926659894  27 APQAHFQRRNWTPQAMLYLKGAQGRRFISDESQRKDLYGRMQLETRSQNTNPLSLSEAAALLLSSLWKAQEV---EEENS 103
gi 297691372  27 APQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPRLLTIPEAATILLASLQKSPED---EEKNF 103
gi 884915781  27 APQRLLERRNWTPQAMLYLKGAQGRRFLSDQSRRKDLSDRLPPERRSPNPQLLPLPEAAALLLALLSKPQEdreekfdrs 106
gi 327272060  27 APQAHFQRRNWTPQAMLYLKGAQGRRFISEESQRKDLYDRLQLETRSQNMSPLTLSEAAALFLSALRKAAQEegdEEEGE 106
                         90
                 ....*....|...
gi 678018975 104 DKSELLEDRLFNW 116
gi 122133489 104 DQTRFLEDSLLNW 116
gi 926659894 104 DHPGYLMDNLSNR 116
gi 297691372 104 DQTRFLEDSLLNW 116
gi 884915781     -------------
gi 327272060 107 EKPGYVSDGLLNW 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap