Conserved Protein Domain Family
Prolactin_RP

?
pfam15172: Prolactin_RP 
Prolactin-releasing peptide
Statistics
?
PSSM-Id: 317574
View PSSM: pfam15172
Aligned: 7 rows
Threshold Bit Score: 63.2396
Threshold Setting Gi: 830000646
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
gi 830000646  29 SMETRAPDINPAWYRGLGIRPVGRFGRRRAALGVVPKPGQ 68
gi 296488785  29 SMEIRTPDINPAWYAGRGIRPVGRFGRRRAALGDGPRPGP 68
gi 301617864  44 QIDNRSPEIDPYWYVGRGVRPIGRFGKRQLKFKKTFQPRL 83
gi 557016932  68 QVDNRNPEIDPFWYVGRGVRPIGRFGKRQIKNSSSVRSgv 107
gi 658908187  50 NVDNRSPEIDPFWYVGRGVRPIGRFGKRHSSMDALGNSGM 89
gi 355565306  27 SMEIRTPDINPAWYTSRGIRPVGRFGRRRAALWDVPKPGL 66
gi 675666407  29 SMETRNPDINPAWYVSRRIRPVGRFGRRRAAPGDVSKPGL 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap