Conserved Protein Domain Family
Myc_target_1

?
pfam15179: Myc_target_1 
Myc target protein 1
This family of proteins is regulated by the c-Myc oncoprotein. It regulates the expression of several other c-Myc target genes.
Statistics
?
PSSM-Id: 317579
View PSSM: pfam15179
Aligned: 17 rows
Threshold Bit Score: 206.104
Threshold Setting Gi: 348510783
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82078943    1 MADNSTHP-IMKILESFGLTDVILAFFLSMVVGLLLGALVYMILTWMSRRRA-SATITRIPVHQSRSTTRSSSPRSRLGY 78
gi 82251736    1 MAHNDTNI-LMEILKTLNHGDMILAFCLSMLVGLLLGALVYVLLTWASRRRA-TAMITRRSKKRPRASQTNSPLGGQIGL 78
gi 130494935   1 MADNSTHP-IMKILESFGLTDVILAFFLSMVVGLLLGALVYMILTWMSRRRA-SATITRIPVHQSRSTTRSSSPRSRLGY 78
gi 532071226  44 imANNTSL-GSPWPENF-WEDLLMSFTVSMAIGLVIGGFIWALLVCLSRRRA-SAPISQWSSSRRRSRSSHTQSLSRSGF 120
gi 611998934   4 MAKNATIL-ESPWPENF-WDDLIMSFTVSMAIGLVIGGIIWALLVCLSRRRA-SAPISRWSSSRRSR--PYSHSLNRTGF 78
gi 597776672   1 MAANENDTdISWIHETIDIEELTLAFCLSMLVGLLIGILIFIFMTWMSRRRA-SARITTRPSRWSRTARSRN-RRSQRGA 78
gi 348510783   1 MAQNKTDP-SLEIDKSFNLGDMILAFCLSVLVGLLLGALIYVLLTWGSRRRA-TARITRHSKKKSGASQTNDATSSQLGL 78
gi 551495461   1 MALNETNA-FLEILKSFNVGDMILAFCLSILVGLLLGALIYVLLTWASRRRA-TARITRRSKKKSGSSR-RDPTGSQFGL 77
gi 597780751   1 MADNSTHP-ILEILQSFGLRDLILAFCLSMVVGLVLGALVYLTLTWMSRRRA-SATITRLPSSRSFRSSSSSSPRSRAAF 78
gi 348524827   1 MAANNTNF-LLEMLQPADVDHLIIAFCASVAVGLLLGALVYVMLTWFSRHKAgSASITRRPHRHSHTS-----SRHRPGF 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82078943   79 SRHSSgydrrsnnslasaaFSFHRQTSSSPIdy--gDSTGRKSSFRASTFHPLLQCSQIAREAEEGAQGSLPRTPTLTTS 156
gi 82251736   79 YRSTF--------------LSVYRQPSLEPV-----GPLGSKPNLETSTFRPASKRSRAPLDMGEDTQVNVAEDPAASNV 139
gi 130494935  79 SRHSSgydrrsnnslasaaFSFHRQTSSSPIdy--gDSTGRKSSFRASTFHPLLQCSQIAREAEEGAQGSLPRTPTLTTS 156
gi 532071226 121 YRHSGcerrsn---lslasLTFQRQASLELA-----NSFPRKSSFRASTFHPFLQCPPLPVQ-TESQLVTLPSSSTSASV 191
gi 611998934  79 YRHSGcerrsn---lslasLTFQRQASLEQA-----NSFPRKSSFRASTFHPFLQCPPLPVE-TDSQLMTLPSTNTSPII 149
gi 597776672  79 YNSNSfnlnse--stgramLNLDRQTSVDPN-----ELLGRSPSFLASTFRPPTKKGSN--ETEDESQTALLHNTSGTNS 149
gi 348510783  79 YRSTF--------------LSVYRQPSLEPV-----GPLGSKPGAETSTFRPLPKKSRPALDMGDDTQVS--EDAAPSNS 137
gi 551495461  78 YRSTF--------------LSVYRQPSLEPV-----GPLGSKPGAETSTFRPLPKKSRPSLDMGDDTRVTMSEDTVAMDS 138
gi 597780751  79 SRHSSaydrrsnnslasaaFSFHRQASCSSPtgdqvDLLGCKSSFRASTFHPLLQCSQIAREAEEGSQGSLPRTPTLTNN 158
gi 348524827  75 NRSSSydrrsnn-slvtaaFTFHRQTSSPDHl----DAMAHKSSFRGSTFHPLLQCSQIAREAEEGSQTTLPRTPPLTTS 149
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 82078943  157 pg-aaGSTSTVS----------SmitpprarnrPD--SFW-GNSNLRGFHAGQTPPPAYDSIIRAYQE 210
gi 82251736  140 -----SDSESLV----------P----------NKrhSFWlGSNGLKGFLTSATPPPAYDSVIHAFEE 182
gi 130494935 157 pg-aaGSTSTVSsmitpprarnR----------PD--SFW-GNSNLRGFHAGQTPPPAYDSIIRAYQE 210
gi 532071226 192 -----NASQPLS----------R----------PD--FHW-SSDSLRVGFSI-PPPPAYDSIIKAFPD 230
gi 611998934 150 -----NTTHSLS----------R----------PD--FHW-SNNSLRVGLSTQTPPPAYESIIKAFPD 189
gi 597776672 150 p---vTDPFNMG----------Q----------SE--SFWlGKGSLRGYLPTQTPPPAYDSVIHMFQE 192
gi 348510783 138 -----SDSASLV----------S----------NKrhSFWlGNNGLKGFLPSQTPPPAYDTVIHAFEE 180
gi 551495461 139 -----SDSASLV----------P----------SKrnSFWlGGNGLKGFLPSHTPPPAYDSVIHAFQE 181
gi 597780751 159 pttttGSTTTVS----------SmvtpprarprPD--SFL-GNSGMRGI---QTPPPAYESIIRAYQE 210
gi 348524827 150 t----GSAQSVA----------Qpaat---pprPE--SFW-GNS-VRGLHATQTPPPAYESIIRAYQE 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap