Conserved Protein Domain Family
CCDC-167

?
pfam15188: CCDC-167 
Coiled-coil domain-containing protein 167
The function of this family of coiled-coil domains, has not, as yet, been determined. Members of this family remain uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between and 103 amino acids in length.
Statistics
?
PSSM-Id: 317586
View PSSM: pfam15188
Aligned: 22 rows
Threshold Bit Score: 62.6432
Threshold Setting Gi: 749778166
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160016608  11 VAREIDGMEEKVALCKYNLDVIDVKLRKMELTEE--GRKSLEKEKSSLSSRLSNYERELKSLRHENRKNMLLSVAIFLLF 88
gi 74781708    6 LQKEIQTTSDTIASLRERVKRMERNLNDPSLPEE--RRREMALELKEISKLLETNEEQLKKMHKENSKSFAVAACLFFIC 83
gi 121956779   7 IQKQIENSNEIIADLRERIRKMERRLTDPQMPEE--RRKEIETEITEIKKMLETNEEMLHKLHRENSKSFAVAACLFFVC 84
gi 642938159  10 VMKEITKTEEAIKACYVRVQLLEKKIESDEIPNE--KKADMKKELREVRKLLTTNENQLSQLHRHNRKSFAFVAAFCFVC 87
gi 242001832   9 VIKEIDKNQAAVHEYLFQLDQIETKLRRTNLSDE--QRVALEDEVRTVKKQLDSLENELTGLRKENRKSMAIAGCLFLLF 86
gi 170064028   3 nphyIETSNETIASLRERIKRVERRLIDAGPGEDayDRPEVE-ELVAIKKLLEDNEQKLHKLHKENSKSFAIAACLFFVC 81
gi 321470726   6 vtteiekreeeikQFYHRIETVEKALRLRELTPD--QRTEFEKELDLLKTVLKNNEEQLKSLQKENYKTGFIAMALIFIC 83
gi 749778166   7 iinkIKHVEDSLKNTLHRVEVIEKKLKTKLLTTE--NRERLENELEEVKEVLRRNEEKLQSLRKENCKSSMTAACLVFLC 84
gi 332023304   9 dmqimEHVEESLKDTLYRVEAIERKLKTKLLTTE--NREKLENELEEVKEVLRRNEKELQNLRKENSKSFMIAACLIFVC 86
gi 557020866  11 VARELDCLEERLTVCKDSLENVDFRLRKEELSPE--GRKSLEEEKLILLEQICKYEKELVRLRKENRKNMLLSVALLALL 88

                 ....
gi 160016608  89 AVGY 92
gi 74781708   84 FLVY 87
gi 121956779  85 FLVY 88
gi 642938159  88 FTVY 91
gi 242001832  87 LIIY 90
gi 170064028  82 FLIY 85
gi 321470726  84 FLVY 87
gi 749778166  85 FLFY 88
gi 332023304  87 FLIY 90
gi 557020866  89 VFLY 92
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap