Conserved Protein Domain Family
Adipogenin

?
pfam15202: Adipogenin 
Adipogenin
This family of proteins is involved in the stimulation of adipocyte differentiation and development.
Statistics
?
PSSM-Id: 317593
View PSSM: pfam15202
Aligned: 3 rows
Threshold Bit Score: 109.269
Threshold Setting Gi: 156630981
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 156630981   1 MKYPLMPLVNDLTFSFLVFWFCLPVGLLL-LLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERP 78
gi 431894382   1 MKYPLVPLVNDLTFSFLVFWLCLPVALLLfLLIVWFRFLLSQDSEENDSDLCFDWEPWSKGPAKFHWDKTRHNQKEERP 79
gi 293358231   1 MKYPLVPLVNDLTLSFLVFWLCLPVSLLLfLMIVWLHFLLSQDSKEDDSDLCFNWEPWSKGPSESGCEGTFSGQ-EDRH 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap