Conserved Protein Domain Family
TMEM95

?
pfam15203: TMEM95 
TMEM95 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 102 and 231 amino acids in length. There is a conserved LGG sequence motif. The function of this family is unknown.
Statistics
?
PSSM-Id: 317594
View PSSM: pfam15203
Aligned: 9 rows
Threshold Bit Score: 242.811
Threshold Setting Gi: 611994432
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 380875429   17 CIFCRLQDHALANRLAQLNNQTKPkwKWKEW-ASPDFSAFALDEVSMKQVTEKTHRVLRVIEKKGSTSLIPLYWQWLQKT 95
gi 987419889   30 CVLCHLSDRDLSGRLARLCNQVEA--RWETCeASWTFPAFALDEVSTNKVIEKTHRVLRVMEIKGSPSSLPLYWQWLQKV 107
gi 611994432   17 CIFCRLPSRDLSGRVAHLCDQISS--EWENCkTSWNFSAFALDDVSMNRITEKTHRVLSIFEIKGSVFSLSSYWHWLQET 94
gi 302564516   17 CVFCRLPAHDLSGRLARLCSRMET--RQKECgASPDFSAFALDEVSMNKVTEKTHRVLRVMEIKEALSSLPSYWSWLRKI 94
gi 198278469   17 CVFCRLPAHALPSRLAQLNKQTEP--QEKECaSSSSFLSISTDEVSMNQITEKTHRVLRVIEIKRSISLLPLYWQWLRKT 94
gi 1040199646  17 CIFCRLPDRDLSGRLARLCSQMEA--QWKEW-ASPDFSAFALDEVTMNKVTEKTHRVLRVIEIKRSLSSLPPYWQWLQKT 93
gi 558201416   17 CLFCRLPAHGLSGRLARLCSQIEA--QWKDCeASWNFSTFALDEVSLNKVTEKTHRVLRVMEIKRSFSSLPLYWQWLQET 94
gi 545860100   17 CIFCRLPDHGLSGRLHQLCSQMEA--QWKDCeASWNFPAFALDDTSMNKVTEKTHRVLRVVEIKGSLSPLPAYWRWLQKT 94
gi 731501452   17 CVFCRLPAHDLLSRLDRLCSQMEV--QWEACeASRDFSAFALDEVSMNKITEKTHRVLRVMEIKGSFSSLPLYWEWLHNT 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 380875429   96 RIPQYTREALCAPVC------------------RGSTILYNCSTCEGKEESCWPQKHCYPD----SHDLWDARILLLCIF 153
gi 987419889  108 KFPEYTREAFCAPACplar----------lspaGGSTVLYNCSTCQSFAVHCWPLKRCLPGaaprSHDLREARILLLSVF 177
gi 611994432   95 KLPESVRQALCPPAC------------------RGITTLYNCSTCKAVEVQCWALKRCFPG----RQDLREARILLLSLS 152
gi 302564516   95 KLPKYTREALCPPACr------------------GSTTLYNCSTCKGMEVSCWPRKRCFPG----SQDLWEAKILLLSVF 152
gi 198278469   95 KIPQYTREALCAPVCplfl----------lspaGGSTILYNCSTCEGKEESCWPQKRCFPG----SHDLWDARILLLCIF 160
gi 1040199646  94 LIPQYTREALCAPACllrp----------lspaGGSTILYNCSTCRSAEVSCWPRKRCSPG----SHDLWEARILLLCVS 159
gi 558201416   95 KFPEYNREALCSPACcevesglplpssvplspaGGSTILYNCSTCEGFEVLCWPQKRCFPG----SHDLREARILLLCVF 170
gi 545860100   95 KLPEYNREALCAPAC------------------RGSTTLYNCSTCEGFEVHCWPRKRCFPG----SHDLWEARILLLSVS 152
gi 731501452   95 KLPEYTREALCAPAC------------------RGSTTLYNCSTCEGVDVHCWPRKLCFPG----SHDLWEARILLFSVF 152
                         170
                  ....*....|....*
gi 380875429  154 GIVLLSGVVSLQVEY 168
gi 987419889  178 TTVLLLGVLSLVVES 192
gi 611994432  153 AALLILGFISCIIES 167
gi 302564516  153 GAVLLLGVLSLLVES 167
gi 198278469  161 GIVLLLGALSLQVEY 175
gi 1040199646 160 GAALLLGVLSLLVES 174
gi 558201416  171 GTILLLGVLSLVVK- 184
gi 545860100  153 GTVLLLGFLSLSVEY 167
gi 731501452  153 VAVLLLSVLSLVVES 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap