Conserved Protein Domain Family
KKLCAg1

?
pfam15204: KKLCAg1 
Kita-kyushu lung cancer antigen 1
This is a family of cancer antigens.
Statistics
?
PSSM-Id: 317595
View PSSM: pfam15204
Aligned: 8 rows
Threshold Bit Score: 113.021
Threshold Setting Gi: 587021643
Created: 3-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 940712842  25 QRNRQMSSSDSTVFVLVRSSSStWSTKRNTVNSLTISNLSQDTL-INFPQSVVIQKLILVNLGMTEYKLVELEHFLVTED 103
gi 344286306  25 QRNIGKMSSNLTALARARPTSP-GSSNSNTEKSLSVNRLSLDILhNNFPHSIAMQKRILVNLRIVEYKLAELEHFLVTKG 103
gi 345807942  23 QSSVGEMSSNSTSLALVRPTSStGSTKSNTDKSLSVNSLSREIL-INFPHTIAMQKQILVNLRIVEYKLAELELFLVFKD 101
gi 587021643  25 QSSVGEMSSSSTSLALVRATSStGSTKSNTDKNLSVDSISRGIL-INSPHTIAMQKRILINLRIVEDKLAELEHFLIIMR 103
gi 63025190   25 QRNTGEMSSNSTALALVRPSSS-GLINSNTDNNLAVYDLSRDIL-NNFPHSIARQKRILVNLSMVENKLVELEHTLLSKG 102
gi 109132003  25 QRNTGEMSSISTAFALLRRSST-GLINSNTDNNLSFNNLSRDIL-NNFPHSIDMQKRLLVNLKRVEYKMAELEYILVSQG 102
gi 675769449  45 nRSTGKMSSNSTAFALVKPYST-GLINSNADNNLSINSLSWDIL-NNFPHSIPMQKRLLVNLRMVEYKLAELEHFLVTKG 122
gi 532067447  21 QRNTGETSSNSTSLALVRTSPS-WSPRSNTD-SLSVNNLSLDIL-NNFPHSIAIQKRILVNLRIVEYKLAELEHFLIIKG 97

                 ....*..
gi 940712842 104 VNGAFVD 110
gi 344286306 104 LNGALVN 110
gi 345807942 102 LNGALVN 108
gi 587021643 104 LNATLAN 110
gi 63025190  103 FRGASPH 109
gi 109132003 103 FRGASGH 109
gi 675769449 123 LRGVSVG 129
gi 532067447  98 ITGALLK 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap