Conserved Protein Domain Family
CDRT4

?
pfam15213: CDRT4 
CMT1A duplicated region transcript 4 protein
Statistics
?
PSSM-Id: 317602
View PSSM: pfam15213
Aligned: 16 rows
Threshold Bit Score: 189.95
Threshold Setting Gi: 395537071
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905905   32 LTENIGLPLILLEKHNPWPAYVAYISPAVTRITEKGWARDLEYIYAAEKNGKPV-KRSKHSAV-LLKRR-KPSKPS-ELM 107
gi 532108410  36 PTENIGLPKKLLDKNDPWPAYVTYICPVVKRLIEKSKTRELEYRKTFGESQQAS-RLNKPSSIlQMGGRiKSFKSSeEAV 114
gi 831227987   7 LTGNIGLPLNLIEKHEPWPAYVTYTSPTVQRLIERSKMREMECVRALEESRRKQnRQHKLSSIiQLKRR-KSPKSSgDAL 85
gi 655868542  51 LTANIGLPLELVDKHDPWPGYVTYTSPVVKRLIEKSKTRELECANAFEESRRAA-KPNKASSIvQLKRR-KSSKSSsEAA 128
gi 13384920   32 LTENIGLPLILLEKHNPWPAYVAYISPAVTRITEKGWARDLEYIYAAEKNGKPV-KRSKHSAVl-LKRR-KPSKPS-ELM 107
gi 611994979  23 SSANIGLPPNLIDKHEPWPAYVTYTSPIVNRLIEQERMRQLDYQKSSQENKWEA-NYNNKPGIiHLSR--KPAKFSaDVT 99
gi 344297919  22 HTENIGLPLNLLEKHDPWPAYVTYTSPVVKRLIEKNRARELECMQTIEEGRRGS-RHTKSSSViQLKRR-KPHKSSsEVV 99
gi 426384209  36 LTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWAS-RQNKPSSViQPKRR-KSSKSSgKAV 113
gi 884896048 101 FTENIGLALNLLEEHDPWPAYVTYISPVVQRLIEKSKPKELQCPRASQQSQSAL-RPNKPSSItQLKRR-KSSMSSgEG- 177
gi 431914464  15 LTENIGLPLKLLEKHDPWPAYVTYTSPVVKRLIEKSKARERECMPDVEERGRTL-RQNKPSSIiQPKRR-KSSKTSdNMM 92
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81905905  108 LKETLSETMLPTWEC-StiYVSPTFVPEPAQL----QMDVREGPTSNYNKIIFSKRPAMRKLP 165
gi 532108410 115 FKDMLSETMLSMLATyS--FLDATVAPEPTYL----QKDSRECPTANYNKIIFPRKPMMRMLP 171
gi 831227987  86 YRDTLSQATLSMWSSySiaAVSPTMMPEPTHI----QTEARDGPTANYNKIIFSQKPKKRTLQ 144
gi 655868542 129 FQDVLSQAMLSVWGAySvlAVGPAISPEPTC----------DSPTATHNKILFSRRPVMRLLP 181
gi 13384920  108 LKETLSETMLPTWEc-StiYVSPTFVPEPAQL----QMDVREGPTSNYNKIIFSKRPAMRKLP 165
gi 611994979 100 FKEHLT-TSVPVLGSyS-----SLTAPQPVIHgtfpQMASKGGPTEAYNSIIFSRKPMMRIFl 156
gi 344297919 100 LKDALSETTLSVWGTcSvmAMAPTALPEPTRF----VTDSRDCPTTNYNKIIFSRKPMMRMVP 158
gi 426384209 114 FRDTLSESTLSMWGAySvlAMAPTMIPEPTHL----HTDSRDCPTENYNKIIFARKPMMRMLP 172
gi 884896048 178 LKDDLSHARLSIWAPnS--ALSPTVVPEPKHK----QPDSRERPTADFNKIIFSRKPMMRMVP 234
gi 431914464  93 FKDMKSETTLSVWGTfSllATGSTVIPEPIPF----HMDSRESPTANYNKIIFSRKPMMRMLP 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap