Conserved Protein Domain Family
PXT1

?
pfam15214: PXT1 
Peroxisomal testis-specific protein 1
This family of proteins is testis-specific.
Statistics
?
PSSM-Id: 317603
View PSSM: pfam15214
Aligned: 6 rows
Threshold Bit Score: 71.0007
Threshold Setting Gi: 81866743
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 81866743    2 QLRHIGDSVNHRVIQEHLAQEVGDVLAPFVALVFVRGQVLLRFFWNNHLL 51
gi 344264376 102 KLKHIGDSINHRTVQEDFQQEGRDALARFILFFFRRVHVVLHFFWNNHLM 151
gi 803187415  86 QLRNIGDSIEQRMVQENFQQEGRAVLAHYVFVFFGGVHMLLRFLWNNHLM 135
gi 953881837  86 QLRNVGDSIDHRMVQEDLQQDGRDALAHFVLVFFGGVHTLLRFLWNNHLM 135
gi 655842564  86 QLRLIGDSINHRMVQEALPLDGRDALPRFVLFFFRRVQVLLRFFWNDHLL 135
gi 297677978  85 QLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHLL 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap