Conserved Protein Domain Family
TEX12

?
pfam15219: TEX12 
Testis-expressed 12
Statistics
?
PSSM-Id: 317606
View PSSM: pfam15219
Aligned: 2 rows
Threshold Bit Score: 164.874
Threshold Setting Gi: 345799932
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 612020996  28 SQLSSLEKPDFVFSENAvPSFYKAEVLEKVLNDMSKEINLLLTKYAQILSERAAVDASYIEEFDAIFKEASTLENLLKQK 107
gi 345799932  28 PQLSSLGKSDSSFSESS-GLFYKDESLEKDLNDMSKEINLMLSTYAKILSERAAVDASYIDEIDGLFKEANTIENFLIQK 106
                         90
                 ....*....|....*.
gi 612020996 108 RESLRQRFTMIANTLQ 123
gi 345799932 107 RELLRQRFTVIANTLH 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap