Conserved Protein Domain Family
DUF4584

?
pfam15223: DUF4584 
Domain of unknown function (DUF4584)
This family of proteins is found in eukaryotes. Proteins in this family are approximately 835 amino acids in length. The family is found in association with pfam02437.
Statistics
?
PSSM-Id: 317608
View PSSM: pfam15223
Aligned: 7 rows
Threshold Bit Score: 382.803
Threshold Setting Gi: 260804195
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  385 SVQAQANFLYHLASAAaat---kpaAFEDAGRLPD--------LKSSVKAESPEEWSLQSWAPKGTPVYCPASLGSCFPE 453
gi 556981201 387 TLLAQASFQYQIPTKT---------HNSDAGRLDEise--gkpTHYDLKFAFQEKKNGQSCLSKPQNVRYSASFGSCFSE 455
gi 973126261 385 PLLAQPSFHYNLHQRPt---------NQSGATLLDygiasrklPKSDVKLGVVKKQQDESHATKQRSL-FPAIPASCFPE 454
gi 768930560 413 PLVLQPTFHYNNQPQHet------qHKRPSPGRDDsrh--ekrQKCEFICTEIGKDFGASQISKLNSV---GAGKCFFTD 481
gi 260804195 352 dsnlsamsslsassdslssdttssdgsdsdsdvssdsddstsssdsncsirfrrpnlSQEQGLQQRSVANGCLQGVGFAL 431
gi 542193518 427 PLVLQPTFHYNNPVQHekeh--rtlGHVAASQSRDrrq--dklQKCEFTCRETEQDSGPSQPQNFNSA---SVGESFFSE 499
gi 620946916 283 GVQAQASLLYRLATAAavvaapkpaAFEEAAGLAD--------LKSGVKAESPEEWSYPIWAPRTPPGCCPASLGSCFAE 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  454 IRNDRVSEITFPHSEISStVKRTDLTInchAEGASSPSP---------------KTNNVF-PQQRILREARKCLQATp-- 515
gi 556981201 456 IKRDRISETAFPHTEFSN-VKNTDPTI---KETISSPSP---------------KKSTEL-SQERIFREAKKCVQST--- 512
gi 973126261 455 SKREREREIALSHFEISDdSKRTDPTInsfKERGSSPCP---------------KENKEF-PQQRILGQANKYPSAP--- 515
gi 768930560 482 HKVEK------------TdPNRNEPSCd---LTSDSSGY---------------NW-KAFqSLRRTTGNPTKCSTGLgaq 530
gi 260804195 432 EGAKNGLQVPLTQFVTSSlSHAPPLDTdclPSPPTSPQSaslvlkkqgkktwavDSIKVSpPQENVLVEREDVRGS---- 507
gi 542193518 500 SKREN--------------LNQADTVEe---LVTYSPGP---------------NRNKAShPSRRTQGHLTKCPPGLraq 547
gi 620946916 355 IRNDRVSEITFPHSEIPNnVKRTDLTIncvAEGASSPSP---------------KTNNAF-PQQRILREARKCLQAT--- 415
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  516 ---------TTHCAEnstiaarflnndscgttansGKDSKIPHCPEFATDLPSLQSDPRVdtataAAAAAAATKAeslct 586
gi 556981201 513 ---------GLHGAEydvlcgsl----tndssensEKESKVSSYSKLPPIFHCIKSDGEL-----SAENQYEEAY----- 569
gi 973126261 516 ---------ISHCAEhketivpqlrdnnsslalnfKKEVKINNCSKLPPPFNTVKTETEEytlstNSHIQSTNTG----- 581
gi 768930560 531 s----lhdkLPKCAE--------------------KREARTS-NQKPTSPLKKIKSETEEtyvtaAPHAVNGKTA----- 580
gi 260804195 508 -----------------------------------KEERKTSCTMKSP-----LRSSPKHgrgrgASRKQNNEVI----- 542
gi 542193518 548 ydhnkeakqTQKCVD--------------------RRDAKAIASPSLPTPLKKIKTESEEpsvtaTSS--SDRTA----- 600
gi 620946916 416 ---------TTHCADnntiaarflnndssaaaansEKGSKILHCIEFATDLPSLQTEPEMdpaaaADPGVAAAAEn---- 482
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  587 gtgdKTL---PF-LHNIKI-------KVEDSSanEEY--EPELITNKLKWECNDAEGEFYNMTEKKEE---------DAL 644
gi 556981201 570 ----QDL---TF-PHNIKI-------KVEENScnEEYdsEAQDIKDKLKYECNVFKEELTNLNENNTR---------EAL 625
gi 973126261 582 ----KAP---TF-LHDVKI-------KVEDNF--DEYssVGEFSETGSEYKHSVDDDDVTTNTK--------------CL 630
gi 768930560 581 ----RTP---PFtLHNVKI-------KVEESS--DEY----EYRAQDASVKCKTDNG--------------------QHQ 620
gi 260804195 543 ----KKPgakKAiLNGTKVslspkqgKVANNF--KKVpsNSQDVSQKKKRKLNNDEAVFSGVKKMRMEhpgekarspQKG 616
gi 542193518 601 ----RTP---PFsLHNVKV-------KVEDSC--DEY----EYQSQATVAKCKGDKTESNNG---------------HYP 645
gi 620946916 483 ----QGW---PF-PHNIKI-------KVEDSStnEEY--EPDLVKHKLKCECNDTKGEFYHVAESKEEeeeeeeeekDAL 545
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  645 VpTAKEGFACPEKETP---------SLNPLAQSQGLSC-------TLGSPKPEDGEYKFGARVRKNYRTLVLG-K-RPVL 706
gi 556981201 626 A-QAKEDFTSTEKQTT---------SQNVLTQSQEPPC-------TLSTPKPEDGEYKYGARVRKNYRTLVLG-K-QAAQ 686
gi 973126261 631 NgADRRTDTLDNANKTtaiaenpaaSQKSPTRNQEFQs-------TLRSPFPELGEYKNGARVRKNYRTLVLG-K-HSEI 701
gi 768930560 621 SdAIKQGDFLSGEITT---------TESGCDVSPISPRgpq--ecDQETPCTDEEQ-----SVSKTCKLAVLR-KtQSRA 683
gi 260804195 617 PnGYIQNATFSP--KL---------SKIPPTLDDTAKLtenelaiKLEAISSEIDNLRRSKTNKKKLKNKVL--P-RTKA 682
gi 542193518 646 SgAIKQGDFSNSGIKA---------TDKSPDVALRSPCgpqecksSQDAPCIEEGEHRH-----KNCRAPVQGnK-KPRV 710
gi 620946916 546 L-TAKEDFACTEKETT---------SLNPLTQSQGLSC-------TLGSPKPEDGEYKFGARVRKNYRTLVLG-K-RPVL 606
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  707 QTPPVKPNLKS----------------ARSPRPTGKTETHEGTLDDFTVL----------------NRRKKVASN-VASA 753
gi 556981201 687 HATPVKANLKS----------------DRSPRPAGKTYLHEGTLEDFTVS----------------NKRKRVASN-VASA 733
gi 973126261 702 QRTPLKLNVK-----------------DRTPRSTGKNEFYEGSLEDLSST----------------GKRKRASSN---MT 745
gi 768930560 684 FGARTKRKLARinaav------sssysSSSCRPGSE----EPATEDLP------------------SRHKRNAGN-PTSP 734
gi 260804195 683 QIPQRKSNLKTskpdl------kgtrkKRKVSPTQKTNLSSKSSEKKDKTlskgiaktqpteegleSRTKKGSYH-SMAP 755
gi 542193518 711 SRTQTKQNLSRvhkaassssssssssySSCSRPVGR---DEASTEDLP------------------SRRKRSNVNtVASP 769
gi 620946916 607 QPPPVKPNLKS----------------ARSPRPTGKTETHEGTLDDFTVT----------------NRRKRVASN-VASA 653
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81895429  754 VKRPFNFMANFPCPPSLIIGKDGDLWPAYSLNTTKDSQPPHKAHPIWKWQLGGSAIPLP---PSHKFRKF 820
gi 556981201 734 VKRPFNFMANFPSPPSLIIGNDGDLFPAYSLNTAKDPQPPHKAHPIWKWQQGGSAIPLP---PSHKFRKF 800
gi 973126261 746 VKKPFNFMANFPSPPSLIIGNDGDLSPAYSLNSVKDNQPPHKSHPVWKWQLGGSAVPLP---PSHKFRKF 812
gi 768930560 735 GKPSFSLMANFPSPPSLVVGSDGDLCPAYSLNSLRGPGPPPPSHPVWRWQPGGHVLPPP---QAQRTRKY 801
gi 260804195 756 GRKTFSLLAQFPWMPTLTIGVDGDLAPAYTMR-LEPGTKPSRKHPAVKWKIGGMPYSKPgtvHASELrkr 824
gi 542193518 770 AKMPFSLMANFPSPPSLIVGSDGDLCPAYSLNSLRGPGPPPPSHPVWRWQPGGQILPPP---HVHRTRK- 835
gi 620946916 654 VKRPFNFMANFPCPPSLIIGNDGDFLPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPLP---PSHKFRKF 720
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap