Conserved Protein Domain Family
PTRF_SDPR

?
pfam15237: PTRF_SDPR 
PTRF/SDPR family
This family of proteins includes muscle-related coiled-coil protein (MURC), protein kinase C delta-binding protein (PRKCDBP), polymerase I and transcript release factor (PTRF) and serum deprivation-response protein (SDPR). MURC activates the Rho/ROCK pathway. PRKCDBP appears to act as an immune potentiator. PTRF is involved in caveolae formation and function. SDPR is involved in the targetting of protein kinase Calpha to caveolae.
Statistics
?
PSSM-Id: 317620
View PSSM: pfam15237
Aligned: 32 rows
Threshold Bit Score: 233.359
Threshold Setting Gi: 410902891
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171704595  19 VSALSILSLLERVSTIIDGVQASQQRMEERQQQLEGSVSAVQSELLKLARDHGATATTVDKLLQKARRVSTHVKEVRSRV 98
gi 511846724  28 DAALTIVTVLDKVATIVDSVQASQKRLEERHREMENAIKSVQIDLLKLSQSHSNTGYVINKLFEKTRKVSAHIKDVKARV 107
gi 551522376  28 ISALTILSLLERVAGIIDNVQSCQQRMEERQLELENNIKTIQGDVLKLAKDHSDTSGTVEKLLQKTRKVSANVKEVRTRV 107
gi 301611613  28 DAALTIVTVLDKVATIVDTVQASQKRIEERHREMEDAIKTIQIELLKLAQAHSNTSYTVNKLLEKTRKVSSNVKDVKSRV 107
gi 56693229   14 pSAMNIFSLLERVSGIIDNVQACQQRMEERQLELENTVKTIQADVVKLTKEHTATSGTVEKLLEKTRKVSCHIKDVRVRV 93
gi 551520567  13 DDAGSIMALLERVAGLMDNVQATQQRMEERQLELENTVKTIQADVVKLTNDHANTSSTVSRLLEKTRKVSCHIKDVRVRV 92
gi 821468114  28 DAALTIVTVLDKVATIIDSVQESQKRIEERHRTMENTIKSVQIDMLKLSQAHNNTGYMVNKLFEKTRKVSAHVKEIKARV 107
gi 658909996  13 ddAGGIMALLERVAGLMDNVQATQQRMEERQLELENTVKTIQADVVKLTNDHANTSSTVSRLLEKTRKVSCHIKDVRVRV 92
gi 565317473  28 DAAFTIVRVLDKVATIVDSVQASQKRIEQRHREMEDAIKTIQIDILKLAQAHGNTGYTVNKLLEKTHKVSARVKEVRARV 107
gi 524987921  29 DAAYTIVTVLDKVANIVDSVQASQKRIEEKHREMENAIKTIQIDILKLAQAHGNTGFTVNKLLQKTRKVSSTMKEVRARV 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171704595  99 EKQNVRVKKVETTQDELLTRNKFRVVIYQGEKEVPSVA-VTKTPKG---AGlAELEVEPDEYDIPADLSSDEEYMVVEDA 174
gi 511846724 108 ERQQVHVKKVESKQEEIMKKNKFRVVIFQEEIRCPTSLsIVKDR-----SLtENQETEEDVFDPPIDLSSDEEYYVEE-- 180
gi 551522376 108 EKQNIRVKKVETTQDELLTRNKFRVVIYQGETEVPSVA-VTKSPKG---LGlEGLDIEPDAYDIPADLSSDEEYLRDEEP 183
gi 301611613 108 DKQSDQVQKVESKQEEMLRKNKFRVVIFQEDIECPTKLtVAKEs--------ALDGNLRDNLYTPDDLSSDEEYCVQE-- 177
gi 56693229   94 EKQNVRVKKVEETQVELLNKNKFRVVIYQGDNEVPAVAgPKASPKG---AMgGDAAADPDAPEAPLP-DSDEEYMVVEEA 169
gi 551520567  93 ENQNLRVKKVEATQGDLLAKNKFRVVIYQGDQEVKAIt-PGNEPAEssgGAaARPEVEPDKFEFPPE--SDEEYMVVEEA 169
gi 821468114 108 EKHSLNVKKVETKQEEILRKNKFRVVIFQEEVPCPTSLsVVKEKs-------LLEDTQEDEFCLPDDLSSDEEYEIEE-- 178
gi 658909996  93 ENQNLRVKKVEATQGDLLAKNKFRVVIYQGDQEVKAIT-PGNEpaetggaaaARPEVEPDKFELPPE--SDEEYMVVEEA 169
gi 565317473 108 EKQNVNVQKVETKQEEMLRKNKFRVVIYQEDIQCPSTLtVVKDr--------TQGESTEDAFCPPDDLSSDEEYYIEE-- 177
gi 524987921 109 ERQSTSVRKVEAKQQEMLRKNKFRVVIYQEETECPSSLsVIKEm--------TAGETIEDDFFPPDDLSSDEEYYIEE-- 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171704595 175 ESSRGARLKQSGLKGIENIKAAFSKENMNKTRektrenlsktkeslsktgQTLGTKFNTLGEKIVPPEQRE-------K- 246
gi 511846724 181 --SRSARLRKSGKERIDNIKKAFSKENMQKTR------------------QNFDKKVNRIRTRIVTPERRErlrqsgeR- 239
gi 551522376 184 DPSRAARLKKSMVKSTETLKAAFSKENMSKTK------------------DNLGTKIHNLGEKVMPPERREkmqqageR- 244
gi 301611613 178 --SRTSRLKKSGMKRIDNIKMAFSKENMQKTK------------------QNFGNKVNRIRTRIVTPERRErirqsgeR- 236
gi 56693229  170 DSSTAAKLKKTGLKRIESLKQTFSRENMTKTK------------------ENLGTKVNKLGERIVTAERREkirqsgeR- 230
gi 551520567 170 DSSSAGRMKKTGLTRIESFKATFSKENMSKTR------------------ENLGTKVNKLGERIVTAERREkirqsgeK- 230
gi 821468114 179 --SRAAQFKKSGKKQIDNIKKAFSKENMQKTR------------------QNFDKKVDRIRTRIVTPERRErirqsgeR- 237
gi 658909996 170 DSSSAGRMKKTGLTRIESFKATFSKENMSKTR------------------ENLGTKVNKFGERIVTAERRE-------Ki 224
gi 565317473 178 --SRTARFKKLGMRRINNIKKAFSRENLQKTR------------------QNFGKKVDRLRTRIVTPERRE-------Ri 230
gi 524987921 179 --SKATKFKKSGMRRIDDIKKAFSRENIQKTR------------------QNFGKKVNRLQTRIVTPERRE-------Ri 231
                        250       260       270
                 ....*....|....*....|....*....|
gi 171704595 247 ------IKQSSe-------RLKENIAKKAP 263
gi 511846724 240 ------LRQSGerlkqsgeRFKKSISNAAP 263
gi 551522376 245 ------LKQSGe-------RLKENIAKKAP 261
gi 301611613 237 ------LKKSGe-------RFKQSIVKAAP 253
gi 56693229  231 ------LKQSGe-------RFKETITKTVP 247
gi 551520567 231 ------LKQSGe-------KLKETFTKTVP 247
gi 821468114 238 ------LRQSGerlrqsgeKLRQSSgerlk 261
gi 658909996 225 rqsgekLKQSGe-------KLKETFTKTVP 247
gi 565317473 231 rqsgerLRQTGi-------RFKKNIANVAP 253
gi 524987921 232 rqsgerLRQSGm-------RIKKSISQAAP 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap